@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1618: (2015-12-09 )
MLYQEFYQSPLGEIRLLADNLGLSGLYFVGQKYDMLAVNQEEIVNMSNSYTLLGKKWLDAYFSQQNLPSIPLSLRGTAFQTRVWQELQKIPFGDTKTYGELAKELNCPSAQAVGGAIGKNPISLIIPCHRVLGRYGQLTGYAGGLERKSWLLEYEKEK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_F_3(1YFH)
MGMT_HUMAN
[Raw transfer]

-

2 PsiBlast_PDB 96.0539% -89 - C10 -4BHC - OGT_MYCTU -
1 PsiBlast_PDB 94.9839% -91 - C10 -4BHB - OGT_MYCTU -
6 PsiBlast_PDB 92.8238%-101 - C10 -4ZYH - ? -
4 PsiBlast_PDB 92.2639% -97 - C10 -4ZYE - ? -
9 PsiBlast_PDB 92.1333% -99 - C10 -1T39 - MGMT_HUMAN -
7 PsiBlast_PDB 91.9538% -92 - C10 -4ZYG - ? -
21 PsiBlast_CBE 91.8033% -99 - C10 -1T39 - MGMT_HUMAN -
14 PsiBlast_PDB 91.5233% -99 - C10 -3KZY - ? -
16 PsiBlast_PDB 91.4532%-103 - C10 -3KZZ - ? -
13 PsiBlast_PDB 91.0633% -94 - C10 -1T38 - MGMT_HUMAN -
24 PsiBlast_CBE 90.8933% -97 - C10 -3KZY - ? -
5 PsiBlast_PDB 90.0738% -90 - C10 -4ZYD - ? -
11 PsiBlast_PDB 89.2533% -88 - C10 -1EH6 - MGMT_HUMAN -
23 PsiBlast_CBE 89.2233% -89 - C10 -1YFH 3.0 MGMT_HUMAN
15 PsiBlast_PDB 88.8433% -96 - C10 -1WRJ - OGT_SULTO -
22 PsiBlast_CBE 88.4833% -92 - C10 -1YFH - MGMT_HUMAN -
8 PsiBlast_PDB 88.4333% -88 - C10 -1QNT - MGMT_HUMAN -
33 HHSearch 88.1535% -89 - C10 -1WRJ - OGT_SULTO -
53 Fugue 86.9932%-100 - C10 -1QNT - MGMT_HUMAN -
10 PsiBlast_PDB 86.9333% -89 - C10 -1YFH - MGMT_HUMAN -