@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1656: (2015-12-09 )
MKKVHLIVSGRVQGVGFRYATYSLALEIGDIYGRVWNNDDGTVEILAQSTDSNKMTQFIQKIRKGPSKWSKVTYVDIKLDNFDDFNDFKMRN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_A_4(1W2I)
ACYP_PYRHO
[Raw transfer]




FMT_A_3(1W2I)
ACYP_PYRHO
[Raw transfer]




62 HHSearch 90.5232%-105 - C8 -1W2I 3.6 ACYP_PYRHO
25 PsiBlast_CBE 90.2732%-121 - C8 -2W4D - ACYP_PYRHO -
26 PsiBlast_CBE 89.9432%-116 - C8 -2W4D - ACYP_PYRHO -
8 PsiBlast_PDB 89.8032%-120 - C8 -2W4D - ACYP_PYRHO -
21 PsiBlast_CBE 89.6332%-122 - C8 -1W2I - ACYP_PYRHO -
27 PsiBlast_CBE 89.3532%-121 - C8 -2W4D - ACYP_PYRHO -
22 PsiBlast_CBE 89.0332%-122 - C8 -1V3Z - ACYP_PYRHO -
7 PsiBlast_PDB 88.9532%-113 - C8 -1V3Z - ACYP_PYRHO -
24 PsiBlast_CBE 88.6232%-122 - C8 -2W4D - ACYP_PYRHO -
66 HHSearch 88.5233%-103 - C8 -2BJD - ACYP_SULSO -
6 PsiBlast_PDB 88.1532%-111 - C8 -1W2I - ACYP_PYRHO -
16 PsiBlast_PDB 87.7532%-111 - C8 -3TNV - ACYP_PYRHO -
61 HHSearch 87.6031%-114 * C8 *1ULR - ACYP_THET8 -
71 HHSearch 87.5837%-103 - C8 -2FHM - ACYP_BACSU -
28 PsiBlast_CBE 87.5132% -98 - C8 -4OJ1 - ACYP_SULSO -
23 PsiBlast_CBE 87.1832%-118 - C8 -2W4D - ACYP_PYRHO -
31 PsiBlast_CBE 87.1132%-101 - C8 -2BJE - ACYP_SULSO -
33 PsiBlast_CBE 86.9032%-107 - C8 -4OJH - ACYP_SULSO -
34 PsiBlast_CBE 86.8331%-105 - C8 -4OJ3 - ACYP_SULSO -
17 PsiBlast_PDB 86.6131%-104 - C8 -4OJ3 - ACYP_SULSO -