@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1672: (2015-12-09 )
MGKKILIIEDEKNLARFVSLELLHEGYDVVVETNGREGLDTALEKDFDLILLDLMLPEMDGFEITRRLQAEKTTYIMMMTARDSVMDIVAGLDRGADDYIVKPFAIEELLARVRAIFRRQEIETKTKEKGDSGSFRDLSLNTHNRSAMRGDEEISLTKREFDLLNVLMTNMNRVMTREELLEHVWKYDVAAETNVVDVYIRYLRGKIDIPGRESYIQTVRGMGYVIREK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_C_3(1NXW)
?
[Raw transfer]




PHS_C_3(1NXP)
?
[Raw transfer]




108 HHSearch 88.4942%-115 - C4 -1KGS - ? -
103 HHSearch 87.2141%-110 - C4 -2GWR - MTRA_MYCTU -
5 PsiBlast_PDB 86.3940%-117 - C4 -1KGS - ? -
9 PsiBlast_PDB 85.2539%-110 - C4 -2GWR - MTRA_MYCTU -
104 HHSearch 84.3640%-112 - C5 -1YS7 - PRRA_MYCTU -
23 PsiBlast_CBE 83.8136%-111 - C4 -4KNY - KDPE_ECOLI -
7 PsiBlast_PDB 82.4536%-110 - C4 -4KNY - KDPE_ECOLI -
6 PsiBlast_PDB 82.4036%-107 - C4 -4KFC - KDPE_ECOLI -
22 PsiBlast_CBE 75.7443% -93 - C5 -1YS6 - PRRA_MYCTU -
21 PsiBlast_CBE 74.8343% -98 - C5 -1YS7 - PRRA_MYCTU -
3 PsiBlast_PDB 74.7643% -94 - C5 -1YS6 - PRRA_MYCTU -
4 PsiBlast_PDB 74.0943% -94 - C5 -1YS7 - PRRA_MYCTU -
2 PsiBlast_PDB 72.6540% -84 - C5 -2OQR - REGX3_MYCTU -
107 HHSearch 72.2737% -88 - C5 -2OQR - REGX3_MYCTU -
1 PsiBlast_PDB 67.5185%-141 - C5 -3RJP - ? -
25 PsiBlast_CBE 65.9348%-109 - C4 -2ZWM - YYCF_BACSU -
24 PsiBlast_CBE 65.8848%-110 - C4 -2ZWM - YYCF_BACSU -
13 PsiBlast_PDB 63.0046%-113 - C4 -1NXV - ? -
26 PsiBlast_CBE 62.6242%-117 - C4 -3NNN - ? -
15 PsiBlast_PDB 62.5846%-118 - C4 -1NXX - ? -
14 PsiBlast_PDB 62.3746%-110 - C4 -1NXW 3.9 ?
11 PsiBlast_PDB 60.0646%-108 - C4 -1NXP 2.9 ?