@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1708: (2015-12-10 )
MEELFCIGCGARIQTENKDAAGYTPRAALEKGLETGELYCQRCFRLRHYNEITDVHITDDEFLKLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFVAGNDVLLVGNKKDILPKSVKDGKVTQWLTERAHEEGLRPVDVILTSAQNHHAIKDLIDTIEKYRHGRDVYVVGVTNVGKSTLINAIIREITGSRDVITTSRFPGTTLDKIEIPLDDGSYIFDTPGIIHRHQMAHYLTAKNLKYVSPKKEIKPKTYQLNSEQTLFLAGLARFDFISGQKQGFTAYFDNNLNLHRTKLVGADEFYTKHVGKLLTPPTGKEVSDFPKLVRHEFTIKNKMDIVYSGLGWIRVKSEAENPVVVAAWAPEGVAVVLRKALI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_A_3(3EC1)
?
[Raw transfer]




GDP_B_4(3EC1)
?
[Raw transfer]




GDP_A_3(3EC1)
?
[Raw transfer]




GDP_A_3(3EC1)
?
[Raw transfer]




DGI_A_2(3H2Y)
?
[Raw transfer]




DGI_A_2(3H2Y)
?
[Raw transfer]




56 HHSearch 95.7257%-121 - C7 -3H2Y 7.2 ?
1 PsiBlast_PDB 95.5956%-121 - C7 -3H2Y 7.2 ?
55 HHSearch 93.8855%-114 - C7 -3EC1 5.1 ?
78 Fugue 93.2854%-114 - C7 -3EC1 5.1 ?
21 PsiBlast_CBE 93.1154%-109 - C7 -3EC1 5.2 ?
2 PsiBlast_PDB 92.3754%-108 - C7 -3EC1 5.1 ?
59 HHSearch 55.8721%-135 * C7 *1PUJ - RBGA_BACSU -
62 HHSearch 51.6923% -89 - C7 -1U0L - RSGA_THEMA -
58 HHSearch 49.1323% -87 - C7 -2YV5 - RSGA_AQUAE -
6 PsiBlast_PDB 47.7627% -78 - C7 -1PUJ - RBGA_BACSU -
60 HHSearch 47.4624% -92 - C7 -3CNL - RBGA_THEMA -
64 HHSearch 44.5720% -83 - C7 -2RCN - RSGA_SALTY -
80 Fugue 43.4619% -43 * C9 *4N5H - ? -
81 Fugue 41.9816% -56 - C4 -1MKY - DER_THEMA -
61 HHSearch 41.7922% -79 - C7 -1T9H - RSGA_BACSU -
9 PsiBlast_PDB 41.2829% -91 - C6 -1U0L - RSGA_THEMA -
5 PsiBlast_PDB 40.9327% -52 - C6 -3CNO - RBGA_THEMA -
4 PsiBlast_PDB 40.4827% -51 - C6 -3CNN - RBGA_THEMA -
73 HHSearch 40.4126% -50 - C6 -2J69 - BDLP_NOSP7 -
3 PsiBlast_PDB 40.4027% -49 - C6 -3CNL - RBGA_THEMA -