@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1822: (2015-12-11 )
MRIADKTVTRAILERHGFTFKKSFGQNFLTDTNILQKIVDTAEIDKGVNVIEIGPGIGALTEFLAENAAEVMAFEIDDRLIPILADTLARFDNVQVVNQDILKADLQTQIQAFKNPDLPIKVVANLPYYITTPILMHLIEGKIPFAEFVVMMQREVADRISAMPNTKAYGSLSIAVQYYMTAKVSFIVPRTVFVPAPNVDSAILKMVRRDQPVVSVQDEDFFFRVSKVAFVHRRKTLWNNLTSHFGKSEDTKAKLEKALEIAKIKPSIRGEALSIPDFASLADALKEVGI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAM_C_3(1ZQ9)
DIM1_HUMAN
[Raw transfer]




21 PsiBlast_CBE 94.2738%-121 - C1 -3FUX - RSMA_THET8 -
22 PsiBlast_CBE 93.9838%-119 - C1 -3FUX - RSMA_THET8 -
3 PsiBlast_PDB 92.3638%-118 - C1 -3FUX - RSMA_THET8 -
2 PsiBlast_PDB 91.3938%-116 - C1 -3FUW - RSMA_THET8 -
1 PsiBlast_PDB 91.2938%-117 - C1 -3FUU - RSMA_THET8 -
42 HHSearch 87.3130%-127 * C1 *1ZQ9 - DIM1_HUMAN -
39 HHSearch 85.8836%-116 - C1 -3GRU - RSMA_METJA -
44 HHSearch 85.2034%-121 - C1 -1QYR - RSMA_ECOLI -
65 Fugue 84.3130%-114 - C1 -1ZQ9 4.0 DIM1_HUMAN
9 PsiBlast_PDB 83.2432%-122 - C1 -4ADV - RSMA_ECOLI -
7 PsiBlast_PDB 83.2333%-124 - C1 -4JXJ - RSMA_RICBR -
23 PsiBlast_CBE 83.1832%-122 - C1 -3TPZ - RSMA_ECOLI -
8 PsiBlast_PDB 82.9732%-122 - C1 -1QYR - RSMA_ECOLI -
45 HHSearch 82.0131%-120 - C1 -3FTD - RSMA_AQUAE -
15 PsiBlast_PDB 81.9937%-127 - C1 -3FYD - RSMA_METJA -
11 PsiBlast_PDB 81.6637%-126 - C1 -3GRU - RSMA_METJA -
5 PsiBlast_PDB 81.6432%-121 - C1 -3TPZ - RSMA_ECOLI -
14 PsiBlast_PDB 81.6136%-129 - C1 -3FYC - RSMA_METJA -
12 PsiBlast_PDB 81.2737%-127 - C1 -3GRV - RSMA_METJA -
13 PsiBlast_PDB 81.0437%-129 - C1 -3GRY - RSMA_METJA -