@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1874: (2015-12-11 )
MSLVGKEIIEFSAQAYHDGKFITVTNEDVKGKWAVFCFYPADFSFVCPTELGDLQEQYETLKSLDVEVYSVSTDTHFVHKAWHDDSDVVGTITYPMIGDPSHLISQGFDVLGQDGLAQRGTFIIDPDGVIQMMEINADGIGRDASTLIDKVRAAQYIRQHPGEVCPAKWKEGAETLTPSLDLVGKI

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_A_4(3VWV)
PRDX4_MOUSE
[Raw transfer]




30 PsiBlast_CBE 97.9360%-118 - C1 -4MA9 - AHPC_SALTY -
29 PsiBlast_CBE 96.1260%-117 - C1 -4MA9 - AHPC_SALTY -
28 PsiBlast_CBE 95.8760%-115 - C1 -4MA9 - AHPC_SALTY -
7 PsiBlast_PDB 95.4559%-113 - C1 -1N8J - AHPC_SALTY -
27 PsiBlast_CBE 94.8960%-118 - C1 -4MA9 - AHPC_SALTY -
41 PsiBlast_CBE 94.1459%-115 - C1 -4MAB - AHPC_SALTY -
42 PsiBlast_CBE 93.8659%-115 - C1 -4MAB - AHPC_SALTY -
40 PsiBlast_CBE 93.5359%-112 - C1 -4MAB - AHPC_SALTY -
39 PsiBlast_CBE 92.6959%-112 - C1 -4MAB - AHPC_SALTY -
6 PsiBlast_PDB 87.1660%-114 - C1 -1YEX - AHPC_SALTY -
4 PsiBlast_PDB 87.0960%-114 - C1 -1YF0 - AHPC_SALTY -
5 PsiBlast_PDB 85.9660%-112 - C1 -1YEP - AHPC_SALTY -
2 PsiBlast_PDB 85.7960%-115 - C1 -1YF1 - AHPC_SALTY -
34 PsiBlast_CBE 85.7460%-113 - C1 -1YEP - AHPC_SALTY -
1 PsiBlast_PDB 85.5471%-112 - C1 -1WE0 - ? -
33 PsiBlast_CBE 85.5260%-115 - C1 -1YEP - AHPC_SALTY -
26 PsiBlast_CBE 85.4660%-118 - C1 -1YF0 - AHPC_SALTY -
22 PsiBlast_CBE 85.3471%-111 - C1 -1WE0 - ? -
9 PsiBlast_PDB 85.2058%-116 - C1 -4QL9 - ? -
24 PsiBlast_CBE 85.0860%-114 - C1 -1YF0 - AHPC_SALTY -
57 PsiBlast_CBE 60.7940% -94 - C1 -3VWV 3.1 PRDX4_MOUSE