@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1878: (2015-12-11 )
MKKLTKGSHIRVLSPSSSIERLGGFEANLLAKEVLEKLGFQVSFSKHYLENDILYSASIASRVEDLHEAFADPSVDAILATIGGFNSNELLPYLDYDLISKNPKIICGYSDSTAFLNAIFAKAKIQTYMGPAYSSFKMKEGQPYQTQAWLTAMTENHYELWPSEEWSSDPWYDPSKPRQFFPTEWKIYNHGKASGTIIGGNLSTFGLLRGTPYAPKIERYVLLIEEAEESNFYEFDRNLAAILQAYPHPQAILMGRFPKECGMTPQVFEYILSKHAIFKEIPVIYDMDFAHTQPLLTVTIGAELSVDTTTLSLSIKE

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_7(3TLY)
MCCF_ECOLX
[Raw transfer]




EDO_A_10(4IIY)
MCCF_ECOLX
[Raw transfer]




GOL_B_5(4MJX)
?
[Raw transfer]




EDO_A_5(3TLY)
MCCF_ECOLX
[Raw transfer]




2 PsiBlast_PDB 98.6743%-105 - C4 -4E5S - ? -
1 PsiBlast_PDB 96.7641%-104 - C4 -4INJ - ? -
3 PsiBlast_PDB 95.4941%-105 - C4 -4H1H - ? -
21 PsiBlast_CBE 94.6341%-101 - C4 -4INJ - ? -
23 PsiBlast_CBE 86.8232% -91 - C4 -3U1B - ? -
24 PsiBlast_CBE 86.0732% -89 - C4 -3T5M - ? -
8 PsiBlast_PDB 85.9231% -89 - C4 -4MJX - ? -
7 PsiBlast_PDB 85.9231% -89 - C4 -4JVO - ? -
5 PsiBlast_PDB 85.7832% -89 - C4 -3U1B - ? -
15 PsiBlast_PDB 85.7731% -87 - C4 -4MI1 - ? -
22 PsiBlast_CBE 85.4732% -89 - C4 -3TYX - ? -
44 HHSearch 85.0931% -95 * C4 *3TLA - MCCF_ECOLX -
6 PsiBlast_PDB 85.0032% -92 - C4 -3T5M - ? -
4 PsiBlast_PDB 83.9332% -87 - C4 -3TYX - ? -
26 PsiBlast_CBE 83.9031% -88 - C4 -4JVO - ? -
25 PsiBlast_CBE 83.3431% -88 - C4 -4MJX 3.1 ?
9 PsiBlast_PDB 82.2832% -79 - C4 -3SR3 - ? -
13 PsiBlast_PDB 79.9731%-102 - C4 -3TLB - MCCF_ECOLX -
28 PsiBlast_CBE 79.4831%-103 - C4 -3TLB - MCCF_ECOLX -
19 PsiBlast_PDB 78.7031% -97 - C4 -3TLZ - MCCF_ECOLX -
29 PsiBlast_CBE 77.4731% -98 - C4 -3TLY 3.0 MCCF_ECOLX
18 PsiBlast_PDB 77.2831% -97 - C4 -4IIY 3.0 MCCF_ECOLX
14 PsiBlast_PDB 77.1931% -98 - C4 -3TLY 2.8 MCCF_ECOLX