@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1917: (2015-12-11 )
MKIAVGCDHIVTYDKIAVVDYLKTKGYEVIDCGTYDNIRTHYPIYGKKVGEAVASGKADLGVCICGTGVGINNAVNKVPGIRSALVRDLTSAIYAKEELNANVIGFGGKITGGLLMTDIIEAFIRAKYKPTKENKVLIEKIAEVETHNAHQEENDFFTEFLDKWNRGEYHD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TG6_B_5(4LFL)
?
[Raw transfer]




TG6_D_6(4LFL)
?
[Raw transfer]




PSJ_D_6(4LFM)
?
[Raw transfer]




PSJ_B_5(4LFM)
?
[Raw transfer]




RBL_D_6(4LFN)
?
[Raw transfer]




RBL_B_5(4LFN)
?
[Raw transfer]




GOL_A_3(3HE8)
?
[Raw transfer]




4 PsiBlast_PDB 96.9855%-113 - C7 -4LFN 2.6 ?
3 PsiBlast_PDB 96.9455%-114 - C7 -4LFM 2.6 ?
22 PsiBlast_CBE 96.8255%-114 - C7 -4LFM 2.5 ?
2 PsiBlast_PDB 96.7755%-115 - C7 -4LFL 3.7 ?
21 PsiBlast_CBE 96.7355%-111 - C7 -4LFN 2.6 ?
23 PsiBlast_CBE 96.1655%-115 - C7 -4LFL 3.4 ?
1 PsiBlast_PDB 95.5255%-117 - C7 -4LFK - ? -
83 HHSearch 83.1342%-117 * C7 *3PH3 - ? -
8 PsiBlast_PDB 82.6142%-117 - C7 -3PH3 - ? -
9 PsiBlast_PDB 82.2840%-112 - C7 -1NN4 - RPIB_ECOLI -
81 HHSearch 82.0942%-112 - C7 -3HE8 2.2 ?
25 PsiBlast_CBE 81.9742%-115 - C7 -3HE8 - ? -
80 HHSearch 81.9140%-111 - C7 -2VVR - RPIB_ECOLI -
10 PsiBlast_PDB 81.7140%-109 - C7 -2VVR - RPIB_ECOLI -
24 PsiBlast_CBE 81.5042%-114 - C7 -3HEE - ? -
5 PsiBlast_PDB 81.5042%-113 - C7 -3HE8 - ? -
27 PsiBlast_CBE 81.3242%-114 - C7 -3PH3 - ? -
7 PsiBlast_PDB 81.1842%-118 - C7 -3PH4 - ? -
6 PsiBlast_PDB 81.0642%-113 - C7 -3HEE - ? -
26 PsiBlast_CBE 80.9942%-112 - C7 -3PH4 - ? -