@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1996: (2015-12-12 )
MDITDYQKWVSEFYKKRNWYQYNSFIRSNFLSEEVGELAQAIRKYEIGRDRPDETEQTDLENLNDIKEELGDVLDNIFILADQYNISLEEIISAHRTN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_6(2Q5Z)
?
[Raw transfer]
30 HHSearch 82.5424% -48 - C1 -2A3Q - DCTP1_MOUSE -
50 Fugue 81.6323% -42 - C1 -2A3Q - DCTP1_MOUSE -
29 HHSearch 81.5326% -51 - C1 -2GTA - YPJD_BACSU -
7 PsiBlast_PDB 81.1825% -41 - C1 -2A3Q - DCTP1_MOUSE -
5 PsiBlast_PDB 80.5325% -34 - C1 -2OIG - DCTP1_MOUSE -
32 HHSearch 80.4831% -25 - C1 -2Q5Z 3.0 ?
31 HHSearch 79.2731% -28 - C1 -2Q73 - ? -
8 PsiBlast_PDB 77.9025% -26 - C1 -2Q4P - DCTP1_MOUSE -
3 PsiBlast_PDB 77.9032% -36 - C1 -2Q9L - ? -
2 PsiBlast_PDB 77.8132% -34 - C1 -2Q73 - ? -
26 PsiBlast_CBE 77.2932% -31 - C1 -2Q73 - ? -
4 PsiBlast_PDB 76.9625% -49 - C1 -2OIE - DCTP1_MOUSE -
21 PsiBlast_CBE 76.4932% -34 - C1 -2Q5Z - ? -
1 PsiBlast_PDB 76.4932% -40 - C1 -2Q5Z - ? -
28 HHSearch 76.1523% -38 - C1 -2OIE - DCTP1_MOUSE -
24 PsiBlast_CBE 75.1832% -31 - C1 -2Q9L - ? -
33 HHSearch 74.8823% -60 - C1 -2YXH - ? -
25 PsiBlast_CBE 69.1032% -35 - C1 -2Q73 - ? -
27 PsiBlast_CBE 68.0332% -29 - C1 -2Q73 - ? -
22 PsiBlast_CBE 67.9432% -30 - C1 -2Q9L - ? -