@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs2021: (2015-12-12 )
MIPRKIRHFLRVKKHVLINNEFINWQTVVQENDTITLIFDDEDYPTKKIPLGRAELIDCLYEDEHLIIVNKPEGMKTHGNQPNEIALLNHVSAYSGQTCYVVHRLDMETSGAVLFAKNPFILPLINQRLERKEIWREYWALVEGKFSPKHQVLRDKIGRNRHDRRKRIIDSKNGQHAMTIIDVLKYIQNSSLIKCRLETGRTHQIRVHLSHHGHPLIGDPLYNPSSNNERLMLHAHRLTLSHPLTCETISVEAPSSTFEKILNNYKKGVG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FOU_E_9(2I82)
RLUA_ECOLI
[Raw transfer]




FOU_E_9(2I82)
RLUA_ECOLI
[Raw transfer]




42 Fugue 96.3629% -94 - C6 -2IST - RLUD_ECOLI -
4 PsiBlast_PDB 91.5533% -99 - C6 -2IST - RLUD_ECOLI -
3 PsiBlast_PDB 91.4033% -99 - C6 -1V9F - RLUD_ECOLI -
22 HHSearch 87.7529% -90 - C6 -1V9F - RLUD_ECOLI -
23 HHSearch 85.7632% -88 - C6 -1V9K - RLUC_ECOLI -
21 PsiBlast_CBE 85.4233% -94 - C6 -1XPI - RLUC_ECOLI -
1 PsiBlast_PDB 84.9433% -96 - C6 -1XPI - RLUC_ECOLI -
24 HHSearch 82.4530% -95 - C6 -2I82 3.0 RLUA_ECOLI
2 PsiBlast_PDB 82.0232% -87 - C6 -1V9K - RLUC_ECOLI -
7 PsiBlast_PDB 79.9430% -89 - C6 -2I82 3.0 RLUA_ECOLI
6 PsiBlast_PDB 67.2733% -47 - C6 -1QYU - RLUD_ECOLI -
5 PsiBlast_PDB 65.6233% -30 - C6 -1PRZ - RLUD_ECOLI -
25 HHSearch 55.6617% -80 - C6 -1VIO - RSUA_HAEIN -
27 HHSearch 55.4617% -92 - C6 -3DH3 - RLUF_ECOLI -
26 HHSearch 52.5514% -70 * C6 *1KSK - RSUA_ECOLI -
29 HHSearch 49.6220% -58 - C6 -2OLW - RLUE_ECOLI -
46 Fugue 48.9014% -45 - C4 -1JDI - ARAD_ECOLI -
30 HHSearch 48.5218% -87 - C6 -2GML - RLUF_ECOLI -
28 HHSearch 47.2820% -59 - C6 -2OML - RLUE_ECOLI -
44 Fugue 46.3313% -60 - C6 -1KSK - RSUA_ECOLI -