@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs2088: (2015-12-13 )
MISFENVSKSYGDHTIIDNISCHIQRGEFFVLVGASGSGKTTILKMINRLIEPSQGAITLDGENITSLDLRQLRLETGYVLQQIALFPNLTVGENIELIPEMKGWSKGDQKKAASDLLDKVGLPAKDYFNRYPHELSGGEQQRIGILRAIVAKPKVLLMDEPFSALDPISRRQLQDITKQLQSELGITLVFVTHDMKEAMRLADRICVIKEGKIVQLDRPEIIQNNPSDQFVRTLFEEEN

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_B_3(4FWI)
?
[Raw transfer]




107 Fugue 94.7541%-112 - C1 -1Z47 - ? -
2 PsiBlast_PDB 90.6140%-113 - C1 -1Z47 - ? -
112 HHSearch 90.4440%-114 - C1 -1Z47 - ? -
22 PsiBlast_CBE 89.7440%-109 - C1 -1Z47 - ? -
19 PsiBlast_PDB 84.3240%-117 - C1 -4TQU - ? -
51 PsiBlast_CBE 84.0638%-104 - C1 -1OXU - ? -
26 PsiBlast_CBE 83.8439%-111 - C1 -3C4J - ? -
10 PsiBlast_PDB 83.6439%-101 - C1 -3C41 - ? -
31 PsiBlast_CBE 83.5839%-101 - C1 -2OLK - ? -
33 PsiBlast_CBE 83.4439%-105 - C1 -2OLK - ? -
35 PsiBlast_CBE 83.3039%-105 - C1 -3C41 - ? -
49 PsiBlast_CBE 83.0938%-103 - C1 -1OXV - ? -
53 PsiBlast_CBE 83.0638%-105 - C1 -1OXU - ? -
113 HHSearch 82.8438%-119 - C1 -1V43 - ? -
4 PsiBlast_PDB 82.8038%-109 - C1 -4U02 - ? -
3 PsiBlast_PDB 82.7038%-107 - C1 -4U00 - ? -
29 PsiBlast_CBE 82.3439%-100 - C1 -2OUK - ? -
48 PsiBlast_CBE 82.2938%-104 - C1 -1OXV - ? -
20 PsiBlast_PDB 82.2040%-118 - C1 -4TQV - ? -
5 PsiBlast_PDB 82.2039%-110 - C1 -2OLJ - ? -
98 PsiBlast_CBE 67.8133%-104 - C1 -4FWI 4.0 ?