@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03180: (2016-06-05 )
MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

XYP_N_(3FYU)
?
[Raw transfer]




107 Fugue 93.8199% -84 * C1 *1L7A - CAH_BACSU -
3 PsiBlast_PDB 93.8199% -84 - C1 -1L7A - CAH_BACSU -
24 PsiBlast_CBE 93.4099% -88 - C1 -1ODS - CAH_BACSU -
26 PsiBlast_CBE 93.3299% -88 - C1 -1ODS - CAH_BACSU -
22 PsiBlast_CBE 93.1999% -87 - C1 -1ODS - CAH_BACSU -
2 PsiBlast_PDB 93.0899% -87 - C1 -1ODS - CAH_BACSU -
25 PsiBlast_CBE 93.0499% -87 - C1 -1ODS - CAH_BACSU -
28 PsiBlast_CBE 93.0299% -86 - C1 -1ODS - CAH_BACSU -
21 PsiBlast_CBE 92.8299% -83 - C1 -1ODT - CAH_BACSU -
23 PsiBlast_CBE 92.6199% -86 - C1 -1ODS - CAH_BACSU -
27 PsiBlast_CBE 92.5699% -86 - C1 -1ODS - CAH_BACSU -
1 PsiBlast_PDB 92.4699% -84 - C1 -1ODT - CAH_BACSU -
88 HHSearch 90.6998% -83 - C1 -1L7A - CAH_BACSU -
5 PsiBlast_PDB 87.6977% -94 - C1 -3FVT - ? -
7 PsiBlast_PDB 87.1277% -90 - C1 -2XLB - ? -
53 PsiBlast_CBE 87.0177% -92 - C1 -3FVR - ? -
55 PsiBlast_CBE 86.9377% -91 - C1 -3FVR - ? -
36 PsiBlast_CBE 86.9177% -94 - C1 -3FVT - ? -
56 PsiBlast_CBE 86.7577% -92 - C1 -3FVR - ? -
34 PsiBlast_CBE 86.6277% -92 - C1 -3FYU - ? -
29 PsiBlast_CBE 84.9177% -91 - C1 -3FYU 3.1 ?