@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03610: (2016-06-06 )
MKKALLALFMVVSIAALAACGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CYS_A_3(2YLN)
?
[Raw transfer]




GDS_B_(4C0R)
?
[Raw transfer]




1 PsiBlast_PDB 81.9653% -50 - C2 -2YLN - ? -
56 HHSearch 80.4452% -56 - C2 -2YLN 2.3 ?
2 PsiBlast_PDB 78.8153% -55 - C2 -3ZSF - ? -
4 PsiBlast_PDB 72.6641% -68 - C2 -4ZV2 - ? -
3 PsiBlast_PDB 72.1041% -69 - C2 -4ZV1 - ? -
19 PsiBlast_PDB 70.6429% -59 - C2 -4OHN - ? -
12 PsiBlast_PDB 70.0732% -75 - C2 -4C0R 3.2 ?
21 PsiBlast_CBE 69.4232% -73 - C2 -4C0R - ? -
47 HHSearch 68.2131% -70 - C2 -3VV5 - ? -
14 PsiBlast_PDB 65.8731% -66 - C2 -4EQ9 - ? -
20 PsiBlast_PDB 65.6630% -65 - C2 -3HV1 - ? -
6 PsiBlast_PDB 65.2530% -74 - C2 -3VV5 - ? -
55 HHSearch 65.1925% -98 - C- -4PRS - ? -
46 HHSearch 64.5326% -70 - C2 -5EYF - ? -
31 Fugue 64.1222% -60 - C2 -4P0G - MLTF_PSEAE -
7 PsiBlast_PDB 63.8430% -74 - C2 -3VVD - ? -
45 HHSearch 63.8028% -68 - C2 -3HV1 - ? -
58 HHSearch 63.5629% -70 * C2 *2PVU - ? -
9 PsiBlast_PDB 63.4630% -75 - C2 -3VVF - ? -
10 PsiBlast_PDB 63.4033% -68 - C2 -1GGG - GLNH_ECOLI -