@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu04440: (2016-06-07 )
MKSLLACLALMIAGIATALFIGFHDHTGNKKIVYDDDQEGLQDQIVFKFSHVVAENTPKGLAANKFADLVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQFIAPSTSKLGMLSPEWGVLDLPYAFTDYNAVKKGLNGSIGTQLFDSLKKNQLKGLAYWTNGFKQITTNQGPVKTPDDLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNVVDGEENTISNIYSKKFYNVQDYLTISSHGYLGYAVMTDEHFWKAQTPETRRILTEAMKETTEWNETYAEQMNKEQLEEIKKNSAIHIYELSDKEKQEWMKRLDPVYRQYEPIFGRELIRELLELRKDS

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SIN_A_2(4MX6)
?
[Raw transfer]




SIN_A_2(4MX6)
?
[Raw transfer]




SIN_A_3(4OVS)
?
[Raw transfer]




SIN_A_3(4OVS)
?
[Raw transfer]




64 HHSearch 92.4841% -43 - C3 -4O94 - ? -
68 HHSearch 92.2339% -47 - C3 -4MX6 4.1 ?
2 PsiBlast_PDB 90.1040% -42 - C3 -4MX6 4.1 ?
3 PsiBlast_PDB 89.6539% -49 - C3 -4OVS 3.5 ?
1 PsiBlast_PDB 89.0241% -41 - C3 -4O94 - ? -
5 PsiBlast_PDB 86.0740% -40 - C3 -4O7M - DCTP_SHELP -
4 PsiBlast_PDB 85.7040% -38 - C3 -4OA4 - DCTP_SHELP -
6 PsiBlast_PDB 85.1137% -41 - C3 -4NF0 - ? -
9 PsiBlast_PDB 84.9626% -50 - C3 -4PDD - ? -
25 PsiBlast_CBE 84.7737% -35 - C3 -4NF0 - ? -
63 HHSearch 84.5426% -51 - C3 -4PDD - ? -
24 PsiBlast_CBE 84.3337% -38 - C3 -4NF0 - ? -
22 PsiBlast_CBE 83.9837% -37 - C3 -4NF0 - ? -
23 PsiBlast_CBE 83.8037% -34 - C3 -4NF0 - ? -
74 HHSearch 82.1723% -71 - C3 -4PF8 - ? -
7 PsiBlast_PDB 82.0432% -62 - C- -4P47 - ? -
73 HHSearch 81.2428% -44 - C3 -4NN3 - ? -
70 HHSearch 81.1324% -55 - C3 -4OAN - ? -
59 HHSearch 80.2223% -65 - C3 -4PFI - ? -
13 PsiBlast_PDB 80.1925% -59 - C3 -4NQ8 - ? -
69 HHSearch 57.7339% 40 - C3 -4OVS 2.6 ?