@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu06500: (2016-06-10 )
MSEAYKNAGVDIEAGYEAVKRMKKHVERTKRLGVMGSLGGFGGMFDLSELSYQKPVLISGTDGVGTKLKLAFSMDKHDTIGVDAVAMCVNDVLAQGAEPLFFLDYLAVGKADPVKIEQIVQGVAEGCEQSGSALVGGETAEMPGLYTADEYDIAGFSVGVAEKDEIVTGEKIEEGHLLIGLSSSGLHSNGFSLVRKVLLDDAELDLDTTYEPFERPLGEELLEPTRIYVKPVLAAVKSGKIDGMAHVTGGGFIENIPRMLPEGLSAEIDHGSWPIPPIFSFLQEYGKLKEEDMFNVFNMGIGFVLAVKEEHLTDVIGTLESHGEKAYLIGRVKKGEGVTFGGAALS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_4(3P4E)
PUR5_VIBCH
[Raw transfer]




2 PsiBlast_PDB 92.6464%-124 - C3 -2Z01 - PUR5_GEOKA -
38 HHSearch 92.1764%-127 - C3 -2Z01 - PUR5_GEOKA -
1 PsiBlast_PDB 92.1169%-115 - C3 -2BTU - PUR5_BACAN -
40 HHSearch 90.2668%-113 - C3 -2BTU - PUR5_BACAN -
22 PsiBlast_CBE 85.8151%-104 - C3 -1CLI - PUR5_ECOLI -
23 PsiBlast_CBE 84.7851%-114 - C3 -1CLI - PUR5_ECOLI -
3 PsiBlast_PDB 84.5251%-105 - C3 -1CLI - PUR5_ECOLI -
39 HHSearch 84.2251%-109 * C3 *3P4E 4.2 PUR5_VIBCH
21 PsiBlast_CBE 83.8751%-107 - C3 -1CLI - PUR5_ECOLI -
41 HHSearch 83.0543%-102 - C3 -3M84 - ? -
4 PsiBlast_PDB 82.9751%-111 - C3 -3P4E - PUR5_VIBCH -
7 PsiBlast_PDB 82.4642%-107 - C3 -3M84 - ? -
8 PsiBlast_PDB 82.2042%-106 - C3 -3QTY - ? -
28 PsiBlast_CBE 79.5444%-116 - C3 -5AVM - ? -
25 PsiBlast_CBE 78.5044%-125 - C3 -5AVM - ? -
37 HHSearch 78.1046%-118 - C3 -5AVM - ? -
27 PsiBlast_CBE 77.9444%-123 - C3 -5AVM - ? -
26 PsiBlast_CBE 77.9044%-116 - C3 -5AVM - ? -
29 PsiBlast_CBE 77.7344%-119 - C3 -5AVM - ? -
6 PsiBlast_PDB 77.6844%-118 - C3 -5AVM - ? -