@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu08720: (2016-06-13 )
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_3(3DRN)
?
[Raw transfer]




CIT_B_4(3DRN)
?
[Raw transfer]




FMT_A_5(3GKM)
?
[Raw transfer]




BIH_A_3(3GKN)
?
[Raw transfer]




1 PsiBlast_PDB 85.7248%-117 - C- -5ENU - ? -
4 PsiBlast_PDB 84.3743%-132 - C1 -3GKN 4.5 ?
21 PsiBlast_CBE 82.7143%-148 - C1 -3GKN - ? -
156 HHSearch 80.7846%-114 - C- -5ENU - ? -
2 PsiBlast_PDB 80.6643%-147 - C1 -3GKK - ? -
3 PsiBlast_PDB 80.0443%-123 - C1 -3GKM 3.5 ?
18 PsiBlast_PDB 79.4537%-146 - C1 -1QMV - PRDX2_HUMAN -
22 PsiBlast_CBE 77.0742%-103 - C1 -3DRN 4.0 ?
13 PsiBlast_PDB 76.9736%-153 - C1 -4KW6 - ? -
6 PsiBlast_PDB 76.3242%-100 - C1 -3DRN 4.0 ?
12 PsiBlast_PDB 75.3136%-156 - C1 -4FH8 - ? -
29 PsiBlast_CBE 75.1936%-147 - C1 -4KW6 - ? -
28 PsiBlast_CBE 75.0836%-147 - C1 -4KW6 - ? -
136 Fugue 74.1735%-128 - C1 -1QMV - PRDX2_HUMAN -
5 PsiBlast_PDB 73.5245%-120 - C- -3IXR - ? -
67 PsiBlast_CBE 72.3232%-144 - C1 -4K1F - ? -
69 PsiBlast_CBE 71.7232%-143 - C1 -4K1F - ? -
70 PsiBlast_CBE 71.6432%-142 - C1 -4K1F - ? -
68 PsiBlast_CBE 71.2932%-143 - C1 -4K1F - ? -
66 PsiBlast_CBE 71.1432%-147 - C1 -4K1F - ? -