@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu09210: (2016-06-14 )
MNQKGRGLEILINEKQDGQWLFSVLKTALKASKPVIQDWMSHQQIKVNHESVLNNMIVKKGDRVFIDLQESEASSVIPEYGELDILFEDNHMLIINKPAGIATHPNEDGQTGTLANLIAYHYQINGETCKVRHVHRLDQDTSGAIVFAKHRLAHAILDQQLEKKTLKRTYTAIAEGKLRTKKGTINSPIGRDRSHPTRRRVSPGGQTAVTHFKVMASNAKERLSLVELELETGRTHQIRVHLASLGHPLTGDSLYGGGSKLLNRQALHANKVQAVHPITDELIVAEAPFPADMKNLCRTYFS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_G_7(1XPI)
RLUC_ECOLI
[Raw transfer]



FOU_E_9(2I82)
RLUA_ECOLI
[Raw transfer]



FOU_E_9(2I82)
RLUA_ECOLI
[Raw transfer]
31 Fugue 90.9935% -90 - C6 -2IST - RLUD_ECOLI -
2 PsiBlast_PDB 85.5235% -86 - C6 -2IST - RLUD_ECOLI -
10 HHSearch 76.3036% -86 - C6 -1V9F - RLUD_ECOLI -
4 PsiBlast_PDB 74.5437% -78 - C6 -1PRZ - RLUD_ECOLI -
3 PsiBlast_PDB 73.9435% -81 - C6 -1QYU - RLUD_ECOLI -
1 PsiBlast_PDB 72.1735% -79 - C6 -1V9F - RLUD_ECOLI -
9 PsiBlast_CBE 72.0535% -70 - C6 -1XPI 3.4 RLUC_ECOLI
11 HHSearch 71.1935% -84 - C6 -1V9K - RLUC_ECOLI -
5 PsiBlast_PDB 70.7635% -75 - C6 -1XPI - RLUC_ECOLI -
6 PsiBlast_PDB 69.2435% -66 - C6 -1V9K - RLUC_ECOLI -
12 HHSearch 67.9631% -80 - C6 -2I82 3.0 RLUA_ECOLI
7 PsiBlast_PDB 67.0230% -80 - C6 -2I82 3.0 RLUA_ECOLI
16 HHSearch 53.6618% -88 - C6 -3DH3 - RLUF_ECOLI -
15 HHSearch 52.1118% -95 * C6 *1KSK - RSUA_ECOLI -
14 HHSearch 50.2118% -88 - C6 -1VIO - RSUA_HAEIN -
33 Fugue 49.8116% -92 - C6 -1KSK - RSUA_ECOLI -
17 HHSearch 48.9321% -63 - C6 -2OML - RLUE_ECOLI -
19 HHSearch 46.9217% -93 - C6 -2GML - RLUF_ECOLI -
18 HHSearch 46.1119% -65 - C6 -2OLW - RLUE_ECOLI -
27 HHSearch 41.2518%-170 - C6 -5A2Q - RS9_HUMAN -