@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10930: (2016-06-17 )
MNETITYDTWNDMLSKQITDQLIDELDVLKWAYRTYGEKIVYACSFGAEGMVLLDLISKINKNAHIIFLDTGLHFQETYELIETVKERYPGFAIQMLEPELSLTEQGTKYGGELWKHNPNLCCQLRKIEPLKKHLSGMTAWISGLRRDQSPTRKHIQYVNLDQKFELIKICPLIHWTWDDVWTYIRLHNLPYNKLHDQHYPSIGCEMCTLPSPDPNDERAGRWAGREKTECGLHQE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

A3P_C_7(2OQ2)
MET16_YEAST
[Raw transfer]




A3P_D_8(2OQ2)
MET16_YEAST
[Raw transfer]




40 HHSearch 87.9239%-114 - C3 -2GOY - CYSH_PSEAE -
1 PsiBlast_PDB 85.9744%-109 - C3 -2GOY - CYSH_PSEAE -
23 PsiBlast_CBE 85.7444%-108 - C3 -2GOY - CYSH_PSEAE -
22 PsiBlast_CBE 85.3144%-113 - C3 -2GOY - CYSH_PSEAE -
20 PsiBlast_CBE 85.2944%-110 - C3 -2GOY - CYSH_PSEAE -
25 PsiBlast_CBE 84.5144%-104 - C3 -2GOY - CYSH_PSEAE -
24 PsiBlast_CBE 84.4244%-114 - C3 -2GOY - CYSH_PSEAE -
21 PsiBlast_CBE 84.0244%-104 - C3 -2GOY - CYSH_PSEAE -
19 PsiBlast_CBE 83.6144%-103 - C3 -2GOY - CYSH_PSEAE -
26 PsiBlast_CBE 82.1732%-104 - C3 -2OQ2 8.2 MET16_YEAST
39 HHSearch 81.5733%-127 * C3 *4BWV - ? -
27 PsiBlast_CBE 81.4132% -92 - C3 -2OQ2 7.6 MET16_YEAST
43 HHSearch 78.5224%-159 - C3 -1ZUN - CYSD_PSESM -
42 HHSearch 77.5029%-126 - C3 -2O8V - CYSH_ECOLI -
2 PsiBlast_PDB 76.6732%-122 - C3 -4BWV - ? -
28 PsiBlast_CBE 76.3632%-122 - C3 -4BWV - ? -
4 PsiBlast_PDB 76.2027%-137 - C3 -1SUR - CYSH_ECOLI -
46 HHSearch 70.2527%-128 - C3 -1SUR - CYSH_ECOLI -
31 Fugue 67.4519%-100 - C3 -3FWK - ? -
3 PsiBlast_PDB 64.8027% 0 - C- -2O8V - CYSH_ECOLI -