@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11630: (2016-06-18 )
MAYDIISDIHGCYDEMTALIQKLGYTIKNGVPVHEEGRVLVFAGDLTDRGPKSIEVIRFVAGAYEKGAVRYVPGNHCNKLYRYLKGNPVKVMHGLETTAAELEELSKDEKKSVSEQFMKLYETAPLYDILHNGELVVAHAGIRADDIGKYTRRVKDFVLYGDVTGETYPDGRPIRRDWAAAYNGKAWVVYGHTPVKEPRKVNRTINIDTGCVFGNQLTGFRFPEIETVSVPSSLPYDESRFRPI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_11(4J6O)
?
[Raw transfer]




CIT_A_11(4J6O)
?
[Raw transfer]




CIT_B_13(4J6O)
?
[Raw transfer]




NHC_A_5(3H63)
PPP5_HUMAN
[Raw transfer]




GOL_A_6(4F0Z)
PP2BA_HUMAN
[Raw transfer]




22 HHSearch 89.9548%-119 - C2 -4J6O 2.9 ?
1 PsiBlast_PDB 89.1148%-119 - C2 -4J6O 2.7 ?
21 PsiBlast_CBE 89.0648%-116 - C2 -4J6O 2.7 ?
24 HHSearch 68.2230%-128 * C2 *2DFJ - APAH_SHIFL -
23 HHSearch 67.4725%-131 - C2 -2QJC - ? -
44 Fugue 63.8929%-136 - C2 -2DFJ - APAH_SHIFL -
2 PsiBlast_PDB 61.5924%-128 - C2 -2DFJ - APAH_SHIFL -
43 Fugue 59.5026%-117 - C2 -2QJC - ? -
42 Fugue 58.7023%-111 - C2 -1G5B - PP_LAMBD -
3 PsiBlast_PDB 56.3827%-125 - C2 -2QJC - ? -
4 PsiBlast_PDB 54.5624%-114 - C2 -1G5B - PP_LAMBD -
25 HHSearch 53.1023%-109 - C2 -1G5B - PP_LAMBD -
6 PsiBlast_PDB 51.9532%-169 - C2 -2Z72 - ? -
47 Fugue 51.7521%-111 - C2 -1TCO - PP2BA_BOVIN -
5 PsiBlast_PDB 49.3732%-155 - C2 -2ZBM - ? -
31 HHSearch 48.1422%-137 - C2 -1FJM - PP1A_RABIT -
7 PsiBlast_PDB 47.0132%-161 - C2 -1V73 - ? -
33 HHSearch 46.7822%-136 - C2 -4MOV - PP1A_HUMAN -
26 HHSearch 43.7017% -98 - C2 -2Z72 - ? -
28 HHSearch 43.3220%-139 - C2 -4I5L - PP2AA_HUMAN -