@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu12970: (2016-06-20 )
MKGVFSLNYKPKALNKGDTVGVIAPASPPDPKKLDTALLFLEELGLQVKLGKALKNQHGYLAGQDDERLADLHEMFRDDEVKAVLCACGGFGTGRIAAGIDFSLIRKHPKIFWGYSDITFLHTAIHQNTGLVTFHGPMLSTDIGLDDVHPLTKASYKQLFQETEFTYTEELSPLTELVPGKAEGELVGGNLSLLTSTLGTPFEIDTRGKLLFIEDIDEEPYQIDRMLNQLKMGGKLTDAAGILVCDFHNCVPVKREKSLSLEQVLEDYIISAGRPALRGFKIGHCSPSIAVPIGAKAAMNTAEKTAVIEAGVSEGALKT

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TLA_A_6(1ZL0)
LDC_PSEAE
[Raw transfer]




EDO_A_10(1ZL0)
LDC_PSEAE
[Raw transfer]




EDO_A_11(1ZL0)
LDC_PSEAE
[Raw transfer]




19 PsiBlast_PDB 76.9228%-117 - C3 -3TLB - MCCF_ECOLX -
18 PsiBlast_PDB 76.2528%-120 - C3 -3TLE - MCCF_ECOLX -
20 PsiBlast_PDB 76.2228%-115 - C3 -3TLG - MCCF_ECOLX -
11 PsiBlast_PDB 76.2029% -92 - C3 -5FD8 - ? -
17 PsiBlast_PDB 75.6328%-116 - C3 -3TLA - MCCF_ECOLX -
16 PsiBlast_PDB 75.4228%-117 - C3 -3TLZ - MCCF_ECOLX -
10 PsiBlast_PDB 74.7629% -86 - C3 -4E5S - ? -
9 PsiBlast_PDB 74.6729%-115 - C3 -4INJ - ? -
14 PsiBlast_PDB 74.5530%-125 - C3 -1ZL0 4.0 LDC_PSEAE
12 PsiBlast_PDB 74.5230%-104 - C3 -4H1H - ? -
24 HHSearch 74.3329%-114 - C3 -4INJ - ? -
3 PsiBlast_PDB 73.6929% -98 - C3 -3T5M - ? -
21 HHSearch 73.6828% -97 - C3 -4E5S - ? -
2 PsiBlast_PDB 73.6129% -96 - C3 -3U1B - ? -
8 PsiBlast_PDB 73.5029% -96 - C3 -4MI1 - ? -
6 PsiBlast_PDB 73.5029% -95 - C3 -4MJX - ? -
5 PsiBlast_PDB 73.3929% -96 - C3 -4JVO - ? -
23 HHSearch 73.2827%-108 - C3 -4JVO - ? -
15 PsiBlast_PDB 72.9330%-132 - C3 -2AUM - LDC_PSEAE -
13 PsiBlast_PDB 72.5830%-130 - C3 -1ZRS - LDC_PSEAE -