@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu14450: (2016-06-22 )
MDSFSQKLNTYAQLAVEVGVNVQKGQYVVVNASTDVRDFVRLIVKHAYEKGAKNVTVNWQDDEVAKLKYELAPFEAFEEYPEWEAKGREELAKNGAAFISVVSSNPDLLKGIDSKRIAAFQKAAGKALHTYRQYIQSDKVSWTVVGAASAGWAHKVFPGKSEEEAIHLLWEEIFKATRVNEDNPVQAWINHDQNLHEKVDHLNERHYAALHYQAEGTDLTIKLPRKHVWAGAGSVNESGHEFMANMPTEEVFTLPQKDGVDGVVSSTKPLSYGGNIIENFTLTFENGRIVDIKAEKGEDILKELVETDEGSHYLGEVALVPYDSPISQSNILFYNTLFDENASNHLAIGSAYAFNIEGGKQMSREELVKEGLNESITHVDFMIGSKDMNIDGITADGKREPIFRNGNWAF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRP_A_5(4ICS)
?
[Raw transfer]




TRP_A_5(4ICS)
?
[Raw transfer]




TRP_B_9(4ICS)
?
[Raw transfer]




GLY_B_10(4ICS)
?
[Raw transfer]




GLY_A_6(4ICS)
?
[Raw transfer]




2 PsiBlast_PDB 80.9751% -73 - C2 -4ICR - ? -
9 PsiBlast_CBE 80.9451% -73 - C2 -4ICR - ? -
7 PsiBlast_CBE 80.4852% -65 - C2 -4ICQ - ? -
8 PsiBlast_CBE 80.3951% -64 - C2 -4ICS 3.3 ?
3 PsiBlast_PDB 80.1951% -61 - C2 -4ICS 4.6 ?
1 PsiBlast_PDB 79.8652% -62 - C2 -4ICQ - ? -
4 PsiBlast_PDB 78.3347% -70 - C2 -1ZJC - ? -
25 HHSearch 78.2450% -57 - C2 -4ICS 4.6 ?
14 Fugue 77.9447% -70 - C2 -1ZJC - ? -
24 HHSearch 77.4647% -69 - C2 -1ZJC - ? -
10 PsiBlast_CBE 75.6044% -83 - C2 -2AYI - AMPT_THET8 -
12 PsiBlast_CBE 75.5944% -81 - C2 -2AYI - AMPT_THET8 -
5 PsiBlast_PDB 74.9944% -80 - C2 -2AYI - AMPT_THET8 -
13 PsiBlast_CBE 74.9344% -80 - C2 -2AYI - AMPT_THET8 -
26 HHSearch 74.4344% -81 * C2 *2AYI - AMPT_THET8 -
11 PsiBlast_CBE 74.2844% -77 - C2 -2AYI - AMPT_THET8 -
28 HHSearch 36.4119%-240 - C2 -2JVF - ? -
27 HHSearch 35.8240%-183 - C2 -4FAS - ? -
15 Fugue 31.2317% -47 - C2 -4K6N - PABC_YEAST -
32 HHSearch 30.8218% -70 - C2 -3O6U - ? -