@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15450: (2016-06-24 )
MLYYMIALLIIAADQLTKWLVVKNMELGQSIPIIDQVFYITSHRNTGAAWGILAGQMWFFYLITTAVIIGIVYYIQRYTKGQRLLGVALGLMLGGAIGNFIDRAVRQEVVDFIHVIIVNYNYPIFNIADSSLCVGVMLLFIQMLLDSGKKKKEQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SER_D_(5DIR)
?
[Raw transfer]




OLC_B_21(5DIR)
?
[Raw transfer]




OLC_A_10(5DIR)
?
[Raw transfer]




5BV_A_9(5DIR)
?
[Raw transfer]




5BV_B_20(5DIR)
?
[Raw transfer]




18 Fugue 76.1639%-156 - C3 -5DIR - ? -
1 PsiBlast_PDB 73.6938%-156 - C3 -5DIR 4.2 ?
5 PsiBlast_CBE 72.2938%-157 - C3 -5DIR 3.6 ?
8 HHSearch 72.2837%-168 - C3 -5DIR - ? -
7 PsiBlast_CBE 70.6938%-160 - C3 -5DIR 4.1 ?
21 Fugue 41.6520%-169 - C3 -1P57 - ? -
19 Fugue 37.9112%-157 - C- -3SUM - ? -
20 Fugue 37.1913%-217 * C5 *1DUT - POL_FIVPE -
12 HHSearch 35.2336%-131 - C4 -1EFV - ETFA_HUMAN -
17 HHSearch 34.5629%-182 - C4 -1O97 - ETFA_METME -
26 Fugue 30.6611%-227 - C2 -3BEH - CNGK1_RHILO -
27 Fugue 29.2218%-123 - C5 -2MQ8 - ? -
14 HHSearch 27.5114%-316 - C3 -2OAR - MSCL_MYCTA -
2 PsiBlast_PDB 26.6243%-160 - C3 -2RGH - ? -
4 PsiBlast_PDB 25.0147%-181 - C3 -3CJX - ? -
16 HHSearch 23.4118%-198 - C4 -4L2I - ? -
10 HHSearch 22.7716%-217 - C3 -4B19 - ? -
24 Fugue 17.6430% 8 - C3 -1M23 - -
11 HHSearch 16.4314% -92 * C4 *4WMY - ITLN1_HUMAN -
3 PsiBlast_PDB 16.2143% 0 - C- -2RGO - ? -