@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu23910: (2016-07-07 )
MVNEKRLLEEFLELVQIDSETKHEAEICKVLKRKFSDLGVDVKEDDTMDITGHGAGNLICTLKGTKQTDTIYFTSHMDTVVPGNGVKPVVENGYVKTDGTTILGADDKAGLAAMFEAIKVLKEENIEHGTIEFIITVGEESGLIGAKALDRSMITASYGYALDSDGKVGNIIVAAPTQAKVRAAIFGKTAHAGVEPEKGISAITIASKAISKMPLGRIDEETTANIGRFEGGTQTNIVCDEVHILAEARSLVPEKMEAQVQKMKAAFEEAAADMGGRAEVEIEVMYPGFKYQDGDQVVEIAKKAAAKIGRPSELQTSGGGSDANVIAGHGIPTVNLAVGYEQIHTKNEKMPIEELVKTAEMVVAIIEEAAK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_7(3RZA)
?
[Raw transfer]




CIT_A_7(3RZA)
?
[Raw transfer]




GOL_A_2(3GB0)
?
[Raw transfer]




GOL_A_19(3PFE)
?
[Raw transfer]




41 HHSearch 83.1679% 14 - C1 -3GB0 3.0 ?
1 PsiBlast_PDB 82.7076% 16 - C1 -3GB0 - ? -
42 HHSearch 76.3356% 22 - C1 -3RZA 2.0 ?
2 PsiBlast_PDB 75.8753% 20 - C1 -3RZA 2.0 ?
43 HHSearch 50.7219% 1 * C1 *3PFO - ? -
51 HHSearch 50.2028% 30 - C1 -1FNO - PEPT_SALTY -
3 PsiBlast_PDB 50.1526% 34 - C1 -1VIX - PEPT_ECOLI -
45 HHSearch 48.9824% 23 - C1 -1CG2 - CBPG_PSES6 -
49 HHSearch 47.9521% 24 - C1 -4PQA - DAPE_NEIMB -
61 HHSearch 47.5922% -5 - C1 -3MRU - ? -
16 PsiBlast_PDB 46.6223% 31 - C1 -4PPZ - DAPE_NEIMB -
5 PsiBlast_PDB 45.8424% 35 - C1 -3IFE - PEPT_BACAN -
48 HHSearch 45.4719% 20 - C1 -2RB7 - ? -
17 PsiBlast_PDB 45.2323% 32 - C1 -4PQA - DAPE_NEIMB -
18 PsiBlast_PDB 44.7222% 35 - C1 -1VGY - DAPE_NEIMB -
60 HHSearch 44.7021% 10 - C1 -1YSJ - YXEP_BACSU -
15 PsiBlast_PDB 44.6423% 34 - C1 -4O23 - DAPE_NEIMB -
4 PsiBlast_PDB 44.4226% 33 - C1 -1FNO - PEPT_SALTY -
54 HHSearch 44.3421% -9 - C1 -4Q7A - ? -
55 HHSearch 43.0517% 6 - C1 -3PFE 3.0 ?