@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu25630: (2016-07-10 )
MNREEALACVKQQLTEHRYIHTVGVMNTAIELAERFGADSKKAEIAAIFHDYAKFRPKEEMKQIIAREKMPAHLLDHNPELWHAPVGAYLVQREAGVQDEDILDAIRYHTSGRPGMTLLEKVIYVADYIEPNRAFPGVDEVRKLAETDLNQALIQSIKNTMVFLMKKNQPVFPDTFLTYNWLVSGS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_A_10(2OGI)
?
[Raw transfer]




GDP_A_10(2OGI)
?
[Raw transfer]




UNL_A_9(2O08)
?
[Raw transfer]




UNL_A_9(2O08)
?
[Raw transfer]




1 PsiBlast_PDB 90.7960% -65 - C2 -2O08 3.3 ?
25 HHSearch 88.5861% -33 - C2 -2O08 3.3 ?
2 PsiBlast_PDB 86.5143%-108 - C2 -2OGI 5.8 ?
24 HHSearch 85.6743%-108 - C2 -2OGI 5.8 ?
23 HHSearch 78.7642% -18 - C2 -3CCG - ? -
3 PsiBlast_PDB 76.7343% -32 - C2 -3CCG - ? -
55 Fugue 45.1416% 6 - C2 -3HC1 - ? -
4 PsiBlast_PDB 42.3430% -8 - C2 -3DTO - ? -
30 HHSearch 42.3316% -27 - C2 -3M1T - ? -
22 PsiBlast_CBE 41.1435% -92 - C2 -4S1B - ? -
33 HHSearch 40.8718% -36 - C2 -2DQB - ? -
43 HHSearch 40.6820% -47 - C2 -2PJQ - ? -
20 PsiBlast_PDB 40.5035%-104 - C2 -4S1C - ? -
46 HHSearch 40.4118% -5 - C2 -2QGS - ? -
51 Fugue 40.2820% 42 - C2 -3TM8 - ? -
40 HHSearch 39.5319%-136 - C2 -4MLM - ? -
32 HHSearch 39.3422% -3 * C2 *3HC1 - ? -
21 PsiBlast_CBE 38.8435% -99 - C2 -4S1C - ? -
29 HHSearch 37.4021% -3 - C2 -4S1B - ? -
50 Fugue 37.1219% -15 - C2 -4S1B - ? -