@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27360: (2016-07-12 )
MTDRYEQINDYIEALLKPRPDNVKRLEAYAEEHHVPIMEKAGMEVLLQILSVKQPKKILEIGTAIGYSAIRMALELPSAEIYTIERNEKRHEEAVNNIKEFQLDDRIHVFYGDALELADAVHVTAPYDVIFIDAAKGQYQNFFHLYEPMLSPDGVIITDNVLFKGLVAEDYSKIEPKRRRRLVAKIDEYNHWLMNHPDYQTAIIPVGDGLAISKKKR

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_C_12(4PCA)
?
[Raw transfer]




SAH_D_17(4PCA)
?
[Raw transfer]




SAH_B_9(4PCA)
?
[Raw transfer]




SAM_A_3(4PCL)
?
[Raw transfer]




FER_A_4(3CBG)
?
[Raw transfer]




SAH_A_7(4OA5)
?
[Raw transfer]




SAH_A_6(4PCA)
?
[Raw transfer]




SAM_B_6(4PCL)
?
[Raw transfer]




1 PsiBlast_PDB 94.9950%-144 - C1 -2GPY - ? -
61 HHSearch 88.3951% -89 - C1 -2GPY - ? -
2 PsiBlast_PDB 85.1737%-124 - C1 -3NTV - ? -
49 HHSearch 84.7036%-122 - C1 -3NTV - ? -
51 HHSearch 68.2125% -59 - C1 -3C3P - ? -
11 PsiBlast_PDB 68.1124% -61 - C1 -3C3P - ? -
60 HHSearch 64.8827% -8 - C1 -2HNK - ? -
62 HHSearch 64.3224% 12 - C1 -4YMH - ? -
50 HHSearch 63.6329% 0 - C1 -4PCA - ? -
39 Fugue 62.2228% -6 - C1 -4OA5 - ? -
42 Fugue 62.1928% 17 - C1 -4PCA - ? -
40 Fugue 62.0023% 14 - C1 -4YMH - ? -
5 PsiBlast_PDB 58.7235% -42 - C1 -4OA8 - ? -
12 PsiBlast_PDB 58.5728% 22 - C1 -1SUI - CAMT_MEDSA -
4 PsiBlast_PDB 58.3535% -44 - C1 -4PCL 7.3 ?
25 PsiBlast_CBE 58.1035% -44 - C1 -4OA8 - ? -
23 PsiBlast_CBE 58.0035% -50 - C1 -4PCA 5.9 ?
48 HHSearch 57.9027% 30 * C1 *1SUI - CAMT_MEDSA -
22 PsiBlast_CBE 57.8935% -45 - C1 -4PCA 6.0 ?
20 PsiBlast_PDB 57.8124% -20 - C1 -2AVD - CMTD1_HUMAN -
3 PsiBlast_PDB 57.0535% -46 - C1 -4PCA 5.5 ?
21 PsiBlast_CBE 56.9835% -41 - C1 -4PCL 7.4 ?
6 PsiBlast_PDB 56.7635% -43 - C1 -4OA5 7.8 ?
24 PsiBlast_CBE 56.4335% -47 - C1 -4PCA 5.7 ?