@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30060: (2016-07-19 )
MKQYDVIVIGGGPSGLMAAIAAGEQGAGVLLIDKGNKLGRKLAISGGGRCNVTNRLPVEEIIKHIPGNGRFLYSAFSEFNNEDIIKFFENLGIQLKEEDHGRMFPVTDKAQSVVDALLNRLKQLRVTIRTNEKIKSVLYEDGQAAGIVTNNGEMIHSQAVIIAVGGKSVPHTGSTGDGYEWAEAAGHTITELFPTEVPVTSGEPFIKQKTLQGLSLRDVAVSVLNKKGKPIITHKMDMLFTHFGLSGPAILRCSQFVVKELKKQPQVPIRIDLYPDINEETLFQKMYKELKEAPKKTIKNVLKPWMQERYLLFLLEKNGISPNVSFSELPKDPFRQFVRDCKQFTVLANGTLSLDKAFVTGGGVSVKEIDPKKMASKKMEGLYFCGEILDIHGYTGGYNITSALVTGRLAGLNAGQYARS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_B_14(4CNK)
?
[Raw transfer]




FAD_A_3(2I0Z)
?
[Raw transfer]




FAD_A_3(2I0Z)
?
[Raw transfer]




FAD_A_3(2I0Z)
?
[Raw transfer]




FAD_A_3(4CNK)
?
[Raw transfer]




FAD_A_3(4CNK)
?
[Raw transfer]




102 HHSearch 74.9570% -59 * C2 *2I0Z 13.8 ?
123 Fugue 74.9169% -55 - C2 -2I0Z 13.8 ?
1 PsiBlast_PDB 74.8570% -56 - C2 -2I0Z 13.8 ?
21 PsiBlast_CBE 65.3744%-104 - C2 -4CNK 13.3 ?
3 PsiBlast_PDB 65.3644%-103 - C2 -4CNK 13.1 ?
23 PsiBlast_CBE 65.1044%-103 - C2 -4CNJ - ? -
22 PsiBlast_CBE 65.1044%-104 - C2 -4CNJ - ? -
2 PsiBlast_PDB 64.5644%-104 - C2 -4CNJ - ? -
24 PsiBlast_CBE 64.4744%-104 - C2 -4CNJ - ? -
101 HHSearch 64.4344%-103 - C2 -4CNK 13.1 ?
4 PsiBlast_PDB 51.8130% -46 - C2 -2GQF - Y933_HAEIN -
109 HHSearch 51.5931% -17 - C2 -2GQF - Y933_HAEIN -
108 HHSearch 51.1730% -20 - C2 -3V76 - ? -
5 PsiBlast_PDB 46.0529% -17 - C2 -3V76 - ? -
32 PsiBlast_CBE 41.7053%-206 - C3 -2Q7V - ? -
14 PsiBlast_PDB 41.5153%-208 - C3 -2Q7V - ? -
61 PsiBlast_CBE 41.1647%-235 - C3 -2BXR - AOFA_HUMAN -
60 PsiBlast_CBE 41.0347%-237 - C3 -2BXR - AOFA_HUMAN -
56 PsiBlast_CBE 40.5547%-207 - C3 -2Z5Y - AOFA_HUMAN -
110 HHSearch 40.4418% 0 - C- -2H88 - SDHA_CHICK -