@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu36360: (2016-07-31 )
MWNEFKAFAMRGNIVDLAIGVVIGGAFGKIVTSLVNDIIMPLVGLLLGGLDFSGLSFTFGDAVVKYGSFIQTIVNFLIISFSIFIVIRTLNGLRRKKEAEEEAAEEAVDAQEELLKEIRDLLKQQAKSPE

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_D_4(4LKU)
?
[Raw transfer]
-
CHAIN_E_5(4LKU)
?
[Raw transfer]
-
39 HHSearch 72.0339%-172 - C1 -2OAR - MSCL_MYCTA -
2 PsiBlast_PDB 65.6637%-152 - C1 -2OAR - MSCL_MYCTA -
22 PsiBlast_CBE 65.6237%-165 - C1 -2OAR - MSCL_MYCTA -
21 PsiBlast_CBE 65.5737%-142 - C1 -2OAR - MSCL_MYCTA -
23 PsiBlast_CBE 64.7837%-158 - C1 -2OAR - MSCL_MYCTA -
29 Fugue 61.6648%-253 - C1 -3HZQ - MSCL_STAAW -
1 PsiBlast_PDB 61.1148%-242 - C1 -3HZQ - MSCL_STAAW -
34 Fugue 60.5422%-303 - C1 -1JEK - -
40 HHSearch 60.3749%-241 - C1 -3HZQ - MSCL_STAAW -
3 PsiBlast_PDB 56.7231%-223 - C1 -4Y7K - RISC_METJA -
41 HHSearch 54.0029%-229 - C1 -4Y7K - RISC_METJA -
6 PsiBlast_PDB 45.3036% -45 - C1 -4LD6 - -
4 PsiBlast_PDB 44.3231%-294 - C1 -4Y7J - RISC_METJA -
24 PsiBlast_CBE 43.3531%-238 - C1 -4Y7J - RISC_METJA -
37 Fugue 41.3220% -5 - C1 -3F5H - ? -
20 PsiBlast_PDB 41.1341% 102 - C1 -3WQZ - SYA_ARCFU -
44 HHSearch 41.0871% - * C1 *4UOT - ? -
35 Fugue 41.0831% 94 - C1 -5CMZ - ? -
31 Fugue 40.9732% 105 - C- -3M91 - PUP_MYCTU -
19 PsiBlast_PDB 40.4541% 86 - C1 -3WQY - SYA_ARCFU -
30 Fugue 38.7851% 39 - C1 -4LKU Error ?
42 HHSearch 36.6852% 10 - C1 -4LKU 4.5 ?