@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu37670: (2016-08-02 )
MSEQQMTNEAAKTLDGWYALHDFRTMDWASWKLLSSDERQSIIHEFTGLLEKWGVAQKEGKGSQTLYSIVGQKADFMLMILRPTMEELNQIELEFNKSRLAEFTIPAYSYVSVVELSNYLASGDGDPYENPHVRARLYPELPESKYVCFYPMDKRRSGNDNWYMLSMEERRNLMRSHGLIGRSYAGKVKQIITGSVGFDDYEWGVTLFSDDVLQFKKLVYEMRFDEVSARYGEFGSFFVGNHLSLDTLPQFLYV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P33_V_11(1T0T)
Y3416_GEOKA
[Raw transfer]




P33_V_11(1T0T)
Y3416_GEOKA
[Raw transfer]




P33_V_11(1T0T)
Y3416_GEOKA
[Raw transfer]




40 HHSearch 96.9868%-130 - C2 -1T0T 4.5 Y3416_GEOKA
29 Fugue 96.6267%-130 - C2 -1T0T 4.5 Y3416_GEOKA
1 PsiBlast_PDB 96.6267%-130 - C2 -1T0T 4.5 Y3416_GEOKA
21 PsiBlast_CBE 96.5667%-125 - C2 -1T0T - Y3416_GEOKA -
24 PsiBlast_CBE 96.4267%-126 - C2 -1T0T - Y3416_GEOKA -
23 PsiBlast_CBE 95.5667%-126 - C2 -1T0T - Y3416_GEOKA -
22 PsiBlast_CBE 95.0967%-124 - C2 -1T0T - Y3416_GEOKA -
28 PsiBlast_CBE 92.0959%-119 - C2 -4WWS - Y2113_LISMO -
26 PsiBlast_CBE 91.9859%-125 - C2 -4WWS - Y2113_LISMO -
27 PsiBlast_CBE 91.1559%-118 - C2 -4WWS - Y2113_LISMO -
25 PsiBlast_CBE 89.4259% -61 - C2 -4WWS - Y2113_LISMO -
2 PsiBlast_PDB 88.6559% -67 - C2 -4WWS - Y2113_LISMO -
39 HHSearch 88.2359% -68 - C2 -4WWS - Y2113_LISMO -
41 HHSearch 83.2249% -92 - C2 -1VDH - Y1714_THET8 -
3 PsiBlast_PDB 80.9948% -88 - C2 -1VDH - Y1714_THET8 -
44 HHSearch 55.5323% -19 - C2 -3NN1 - ? -
42 HHSearch 53.2319% -24 - C2 -5A12 - ? -
30 Fugue 49.5021% -18 - C2 -2VXH - ? -
11 PsiBlast_PDB 48.0525% -11 - C2 -3NN2 - ? -
10 PsiBlast_PDB 46.8425% -15 - C2 -3NN1 - ? -