@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu39250: (2016-08-05 )
MFNKMLVAIDGSDMSAKALDAAVHLAKEQQAELSILHVGREAVVTTSSLTGIVYVPEHFIDEIRNEVKKEGLKILENAKEKAAEKGVQAETIYANGEPAHEILNHAKEKGVSLIVVGSRGISGLKEMMLGSVSHKVSQLSTCPVLIVR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_5(3HGM)
TEAD_HALED
[Raw transfer]




AMP_A_2(3TNJ)
?
[Raw transfer]




ATP_D_11(3HGM)
TEAD_HALED
[Raw transfer]




32 HHSearch 80.8335% -58 - C1 -3HGM - TEAD_HALED -
1 PsiBlast_PDB 80.8235% -60 - C1 -3HGM - TEAD_HALED -
3 PsiBlast_PDB 79.9832%-120 - C1 -4WNY - ? -
23 PsiBlast_CBE 79.6135% -50 - C1 -3HGM 2.1 TEAD_HALED
21 PsiBlast_CBE 78.2835% -55 - C1 -3HGM - TEAD_HALED -
22 PsiBlast_CBE 77.7335% -67 - C1 -3HGM Error TEAD_HALED
2 PsiBlast_PDB 76.4430%-118 - C1 -1MJH - Y577_METJA -
43 HHSearch 71.8933% -89 - C1 -2Z08 - ? -
34 HHSearch 69.2832% -69 - C1 -4WNY - ? -
56 Fugue 67.9727% -94 - C1 -3AB8 - ? -
6 PsiBlast_PDB 67.9135% -59 - C1 -2Z09 - ? -
50 Fugue 67.3233% 9 - C1 -1MJH - Y577_METJA -
10 PsiBlast_PDB 67.2130% -80 - C1 -3LOQ - ? -
5 PsiBlast_PDB 66.8835% -55 - C1 -2Z08 - ? -
42 HHSearch 66.6432% -75 - C1 -3LOQ - ? -
7 PsiBlast_PDB 66.3035% -49 - C1 -2Z3V - ? -
49 Fugue 65.3431% 7 - C1 -1MJH - Y577_METJA -
28 HHSearch 64.0731% -6 - C1 -1MJH - Y577_METJA -
15 PsiBlast_PDB 63.8528%-127 - C1 -2PFS - ? -
4 PsiBlast_PDB 63.4635% -34 - C1 -1WJG - ? -