@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu39490: (2016-08-05 )
MNTIDWEFMISAFPTLIQALPITLFMAIAAMIFAIIGGLILALITKNKIPVLHQLSKLYISFFRGVPTLVQLFLIYYGLPQLFPEMSKMTALTAAIIGLSLKNAAYLAEIFRAALNSVDDGQLEACLSVGMTKFQAYRRIILPQAIRNAIPATGNTFIGLLKETSLAFTLGVMEMFAQGKMYASGNLKYFETYLAVAIVYWVLTIIYSILQDLFERAMSKPYRT

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_D_9(4YMU)
?
[Raw transfer]




ARG_C_10(4YMU)
?
[Raw transfer]




ARG_C_10(4YMU)
?
[Raw transfer]




ARG_D_9(4YMU)
?
[Raw transfer]




HIS_D_5(4YMW)
?
[Raw transfer]




HIS_D_5(4YMW)
?
[Raw transfer]




23 PsiBlast_CBE 89.7739%-170 - C4 -4YMT - ? -
22 PsiBlast_CBE 88.3939%-167 - C4 -4YMU 2.0 ?
34 Fugue 87.8439%-166 - C4 -4YMU 2.0 ?
1 PsiBlast_PDB 87.4439%-169 - C4 -4YMS - ? -
2 PsiBlast_PDB 87.4139%-168 - C4 -4YMT - ? -
24 HHSearch 87.4038%-166 - C4 -4YMU 2.6 ?
4 PsiBlast_PDB 87.3039%-170 - C4 -4YMV - ? -
5 PsiBlast_PDB 87.0639%-167 - C4 -4YMW 3.8 ?
3 PsiBlast_PDB 86.2439%-169 - C4 -4YMU 2.6 ?
21 PsiBlast_CBE 86.1639%-167 - C4 -4YMW 2.5 ?
27 HHSearch 66.8221%-121 - C4 -3TUI - METI_ECOLI -
25 HHSearch 66.3317%-124 - C4 -3D31 - ? -
26 HHSearch 65.4913%-130 * C4 *2ONK - WTPB_ARCFU -
28 HHSearch 63.5418%-143 - C4 -3RLF - MALF_ECOLI -
36 Fugue 59.8114%-119 - C4 -2ONK - WTPB_ARCFU -
35 Fugue 59.3820%-122 - C4 -3DHW - METI_ECOLI -
43 Fugue 58.7215%-189 - C3 -1AA7 - M1_I34A1 -
8 PsiBlast_PDB 55.2526%-170 - C4 -3TUZ - METI_ECOLI -
9 PsiBlast_PDB 55.0226%-161 - C4 -3TUJ - METI_ECOLI -
7 PsiBlast_PDB 54.7426%-172 - C4 -3TUI - METI_ECOLI -