@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2573: (2016-05-12 )
MHKAGYSPLLCGHTPRAGIELRRDGADPIVVPGPVHTSPREVAGPVDVLILAVKATQNDAARPWLTRLCDERTVVAVLQNGVEQVEQVQPHCPSSAVVPAIVWCSAETQPQGWVRLRGEAALVVPTGPAAEQFAGLLRGAGATVDCDPDFTTAAWRKLLVNALAGFMVLSGRRSAMFRRDDVAALSRRYVAECLAVARAEGARLDDDVVDEVVRLVRSAPQDMGTSMLADRAAHRPLEWDLRNGVIVRKARAHGLATPISDVLVPLLAAASDGPG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_2(4OL9)
PANE_MYCTU
[Raw transfer]




NAP_A_2(4OL9)
PANE_MYCTU
[Raw transfer]




1 PsiBlast_PDB 99.2099%-131 - C6 -4OL9 10.7 PANE_MYCTU
21 HHSearch 98.3999%-129 - C6 -4OL9 10.7 PANE_MYCTU
20 PsiBlast_CBE 71.0531%-120 - C6 -4YCA - ? -
4 PsiBlast_PDB 70.7131%-124 - C6 -4YCA - ? -
3 PsiBlast_PDB 70.2231%-119 - C6 -3G17 - ? -
28 HHSearch 69.1429%-115 - C6 -4YCA - ? -
7 PsiBlast_PDB 67.4925%-119 - C6 -3WFI - ? -
2 PsiBlast_PDB 67.3431%-137 - C6 -4S3M - ? -
19 PsiBlast_CBE 66.7831%-133 - C6 -4S3M - ? -
9 PsiBlast_PDB 65.7826%-127 - C6 -3HN2 - ? -
27 HHSearch 65.3123%-107 - C6 -3I83 - ? -
8 PsiBlast_PDB 64.6525%-121 - C6 -3WFJ - ? -
23 HHSearch 64.3424%-106 - C6 -3WFI - ? -
32 HHSearch 64.1828%-104 - C6 -3HWR - ? -
30 HHSearch 64.1122% -99 - C6 -5AYV - ? -
6 PsiBlast_PDB 63.7325%-112 - C6 -2EW2 - ? -
25 HHSearch 62.8823%-106 - C6 -3HN2 - ? -
22 HHSearch 62.8025%-107 - C6 -2EW2 - ? -
16 PsiBlast_PDB 62.2024%-102 - C6 -5AYV - ? -
24 HHSearch 61.8419%-119 - C6 -2QYT - ? -