@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0214: (2015-12-26 )
MSVLFAYPGQGAQRPGMLAALPDEPPVRACLEQAADCLGQAPAELESAEALRGTRAVQLCLLIAGVAASRLLETRGHRPGLVAGLSIGAYPAAVVAGALDFDDALRLVALRGELMQAAWPEGYGMSAILGLEQAQLEALILAVRREHPPLYLANVNAERQLVVAGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAGIRLHRPRVPYLSSSRARLVAEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARPLFGCATPAFEGSRADTLDALLREEEKRTR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NHE_A_2(3R97)
?
[Raw transfer]




GOL_A_2(3K89)
?
[Raw transfer]




GOL_A_2(3K89)
?
[Raw transfer]




ACY_A_4(1NM2)
?
[Raw transfer]




42 HHSearch 93.0236%-115 - C1 -1MLA - FABD_ECOLI -
6 PsiBlast_PDB 92.2537%-114 - C1 -2G2O - FABD_ECOLI -
5 PsiBlast_PDB 92.0837%-113 - C1 -2G1H - FABD_ECOLI -
4 PsiBlast_PDB 91.8837%-113 - C1 -1MLA - FABD_ECOLI -
7 PsiBlast_PDB 91.7237%-112 - C1 -2G2Y - FABD_ECOLI -
2 PsiBlast_PDB 91.6439%-105 - C1 -3K89 3.0 ?
10 PsiBlast_PDB 91.5636%-112 - C1 -3H0P - FABD_SALTY -
3 PsiBlast_PDB 91.3639%-105 - C1 -3R97 3.1 ?
8 PsiBlast_PDB 91.3437%-110 - C1 -2G2Z - FABD_ECOLI -
40 HHSearch 90.3030%-106 - C1 -3QAT - ? -
15 PsiBlast_PDB 88.7330%-110 - C1 -3QAT - ? -
13 PsiBlast_PDB 88.4029%-117 - C1 -4RR5 - FABD_SYNY3 -
52 HHSearch 88.0133%-118 - C1 -3IM8 - ? -
49 HHSearch 87.8136%-114 - C1 -3TQE - ? -
11 PsiBlast_PDB 87.4534%-110 - C1 -3HJV - ? -
51 HHSearch 86.5036%-111 - C1 -3K89 3.0 ?
36 HHSearch 86.2426%-102 - C1 -3PTW - ? -
12 PsiBlast_PDB 86.0534%-114 - C1 -3IM8 - ? -
9 PsiBlast_PDB 85.2835%-103 - C1 -3TQE - ? -
14 PsiBlast_PDB 85.2027%-110 - C1 -3PTW - ? -
55 Fugue 83.9733% -95 - C1 -1NM2 2.7 ?