@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0245: (2015-12-27 )
MTRTVLVLNGPNLNLLGTREPQTYGRRTLGEIADECAAFAETRGFAVDFRQTNQEGQLLDWIHQARGRVAGIVINPAAWTHTSVALRDALAAVELPVVEVHLSNVHQREAFRHHSYVSPVALGVICGFGSLGYRLALEHFAERFEAAA

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_L_(1GU1)
AROQ_STRCO
[Raw transfer]
133 Fugue 93.3355%-134 - C6 -1D0I - AROQ_STRCO -
117 HHSearch 93.0256%-155 - C- -2UYG - AROQ_THET8 -
23 PsiBlast_CBE 92.8456%-139 - C6 -4RC9 - AROQ_ACIBT -
1 PsiBlast_PDB 92.8161%-153 - C6 -4L8L - AROQ1_PSEAE -
26 PsiBlast_CBE 92.7056%-139 - C6 -4RC9 - AROQ_ACIBT -
13 PsiBlast_PDB 92.4455%-157 - C- -2UYG - AROQ_THET8 -
24 PsiBlast_CBE 92.2456%-139 - C6 -4RC9 - AROQ_ACIBT -
21 PsiBlast_CBE 92.0956%-140 - C6 -4RC9 - AROQ_ACIBT -
28 PsiBlast_CBE 91.9456%-136 - C6 -4RC9 - AROQ_ACIBT -
30 PsiBlast_CBE 91.4156%-137 - C6 -4RC9 - AROQ_ACIBT -
22 PsiBlast_CBE 91.3756%-136 - C6 -4RC9 - AROQ_ACIBT -
113 HHSearch 91.3155%-135 - C6 -1GTZ - AROQ_STRCO -
27 PsiBlast_CBE 91.0856%-133 - C6 -4RC9 - AROQ_ACIBT -
5 PsiBlast_PDB 90.8557%-147 - C6 -2BT4 - AROQ_STRCO -
55 PsiBlast_CBE 90.6557%-144 - C6 -1V1J - AROQ_STRCO -
89 PsiBlast_CBE 90.6257%-145 - C6 -1D0I - AROQ_STRCO -
3 PsiBlast_PDB 90.6156%-138 - C6 -4RC9 - AROQ_ACIBT -
34 PsiBlast_CBE 90.4457%-147 - C6 -2CJF - AROQ_STRCO -
81 PsiBlast_CBE 90.4157%-150 - C6 -1GU0 - AROQ_STRCO -
51 PsiBlast_CBE 90.3657%-148 - C6 -2BT4 - AROQ_STRCO -
67 PsiBlast_CBE 89.8557%-147 - C6 -1GU1 3.1 AROQ_STRCO