@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0559: (2016-01-09 )
MASTDVLIVGAGAAGLMCAMTAAGRGRRVRVLDHANKAGKKILMSGGGRCNFTNLYTEPANFLSRNPHFCKSALARYTQWDFIGLVAKHQVPYHEKKLGQLFCDNKSSDILEMLLRECAEAGAEILLDTSIEEIARDDAGYRLRTSAGEMRCESLVIASGGLSIPTLGASGFGYQVARQFGHEVLPTRAGLVPFTITDQLKELCAELSGTSVDCRVSCNGQAFRENLLFTHRGLSGPAMLQISSYWQPGDTLEIDLLPDHDASEWLAQQQRERPNSELKTLLAELFTKKLAGLLADRWFVSKPMKQYTPTELAGIAGQLSAWRVTPSGTEGYRTAEVTLGGVSTDEVSSKTMESQRSPGLYFVGEVLDVSGHLGGFNFQWAWASGYAAGQYA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FDA_A_2(3V76)
?
[Raw transfer]




FAD_A_3(2GQF)
Y933_HAEIN
[Raw transfer]




FAD_A_3(2GQF)
Y933_HAEIN
[Raw transfer]




FDA_A_2(3V76)
?
[Raw transfer]




1 PsiBlast_PDB 91.1551%-110 - C2 -2GQF 11.1 Y933_HAEIN
129 HHSearch 89.8251%-105 - C2 -3V76 12.2 ?
130 HHSearch 89.2351%-100 - C2 -2GQF 11.1 Y933_HAEIN
2 PsiBlast_PDB 82.3550% -97 - C2 -3V76 10.9 ?
21 PsiBlast_CBE 78.0432% -96 - C3 -4CNK - ? -
4 PsiBlast_PDB 77.3732% -98 - C3 -4CNK - ? -
22 PsiBlast_CBE 77.2532% -96 - C3 -4CNJ - ? -
3 PsiBlast_PDB 77.1432% -97 - C3 -4CNJ - ? -
23 PsiBlast_CBE 76.6432% -98 - C3 -4CNJ - ? -
24 PsiBlast_CBE 75.8332% -98 - C3 -4CNJ - ? -
120 Fugue 73.0329% -88 - C2 -2I0Z - ? -
5 PsiBlast_PDB 72.8531% -92 - C2 -2I0Z - ? -
131 HHSearch 71.1330% -86 - C2 -2I0Z - ? -
141 HHSearch 55.6720% -59 - C2 -1QO8 - FRD2_SHEFN -
135 HHSearch 53.0118% -69 - C2 -2WDQ - SDHA_ECOLI -
134 HHSearch 52.6320% -75 - C2 -1KF6 - FRDA_ECOLI -
137 HHSearch 52.2819% -58 - C2 -1Y0P - FRDA_SHEFR -
139 HHSearch 52.2219% -65 - C2 -2E5V - NADB_SULTO -
136 HHSearch 51.0119% -83 - C2 -1CHU - NADB_ECOLI -
133 HHSearch 51.0118% -75 - C2 -2BS2 - FRDA_WOLSU -