@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00018_ITK_HU: (2014-08-10 )
NNSLVPKYHPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETNDNPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESGL

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0G1_A_5(3V5L)
ITK_HUMAN
[Raw transfer]




0G1_C_8(3V5L)
ITK_HUMAN
[Raw transfer]




0G1_D_9(3V5L)

[Raw transfer]




0F2_A_3(3V5J)
ITK_HUMAN
[Raw transfer]




GOL_A_3(3T9T)

[Raw transfer]




0F2_B_5(3V5J)

[Raw transfer]




13L_A_2(4HCU)

[Raw transfer]




614_A_2(3MJ1)

[Raw transfer]




G5K_B_6(4KIO)
ITK_HUMAN
[Raw transfer]




13J_A_2(4HCV)

[Raw transfer]




13L_A_2(4HCU)

[Raw transfer]




L7O_B_4(3QGY)

[Raw transfer]




0G2_A_3(3V8W)
ITK_HUMAN
[Raw transfer]




PQC_A_3(3QGY)
ITK_HUMAN
[Raw transfer]




G5K_A_5(4KIO)
ITK_HUMAN
[Raw transfer]




18R_A_2(4HCT)

[Raw transfer]




PQC_A_3(3QGW)
ITK_HUMAN
[Raw transfer]




0G2_B_5(3V8W)

[Raw transfer]




G6K_C_7(4KIO)
ITK_HUMAN
[Raw transfer]




G7K_B_4(4L7S)
?
[Raw transfer]




29Y_B_4(4MF1)

[Raw transfer]




MJG_A_2(3MJ2)

[Raw transfer]




STU_D_4(1SM2)

[Raw transfer]




STU_D_4(1SNU)

[Raw transfer]




STU_C_3(1SNU)
ITK_HUMAN
[Raw transfer]




L7A_B_4(3QGW)

[Raw transfer]




G7K_A_3(4L7S)
?
[Raw transfer]




STU_C_3(1SM2)
ITK_HUMAN
[Raw transfer]




29Y_A_3(4MF1)
ITK_HUMAN
[Raw transfer]




477_A_3(3V8T)
ITK_HUMAN
[Raw transfer]




B43_A_2(3GEN)

[Raw transfer]




477_B_4(3V8T)

[Raw transfer]




IAQ_A_2(3T9T)

[Raw transfer]




GOL_A_5(3KUL)
EPHA8_HUMAN
[Raw transfer]




ANP_A_3(2OZO)
ZAP70_HUMAN
[Raw transfer]




PP1_B_2(1QCF)
HCK_HUMAN
[Raw transfer]




STU_A_2(1U59)

[Raw transfer]




P16_A_3(1OPK)
ABL1_MOUSE
[Raw transfer]




29Z_A_3(4MF0)
ITK_HUMAN
[Raw transfer]




ANP_C_3(1MQB)
EPHA2_HUMAN
[Raw transfer]




STU_B_2(1BYG)
CSK_HUMAN
[Raw transfer]




H8H_A_2(2H8H)
SRC_HUMAN
[Raw transfer]




PP2_A_2(3SXS)

[Raw transfer]




0VF_A_2(4FYO)

[Raw transfer]




03P_A_5(3POZ)

[Raw transfer]




V4Z_A_4(4AOJ)
NTRK1_HUMAN
[Raw transfer]




G6K_C_7(4KIO)
ITK_HUMAN
[Raw transfer]




G5K_A_5(4KIO)
ITK_HUMAN
[Raw transfer]




G6K_D_12(4KIO)
ITK_HUMAN
[Raw transfer]




47 HHSearch 86.9138%-110 - C3 -1OPK 7.6 ABL1_MOUSE
48 HHSearch 85.1037%-111 - C3 -2H8H 7.3 SRC_HUMAN
46 HHSearch 84.1237%-114 - C3 -1QCF 4.9 HCK_HUMAN
3 PsiBlast_PDB 80.7799%-135 - C3 -4HCV 9.1
1 PsiBlast_PDB 80.6599%-134 - C3 -4HCT 10.3
53 HHSearch 80.3299%-133 - C3 -4HCU 9.8
4 PsiBlast_PDB 78.6799%-133 - C3 -3T9T 4.1
14 PsiBlast_PDB 78.5699%-134 - C3 -4L7S 7.5 ?
29 PsiBlast_CBE 78.3599%-135 - C3 -4L7S 7.9 ?
23 PsiBlast_CBE 78.29100%-140 - C3 -3V5L 8.1
18 PsiBlast_PDB 78.2198%-127 - C3 -3MJ2 7.6
25 PsiBlast_CBE 78.18100%-145 - C3 -3V5J 7.1
30 PsiBlast_CBE 78.1799%-137 - C3 -4KIO 5.5 ITK_HUMAN
21 PsiBlast_CBE 77.85100%-141 - C3 -3V8W 3.3
8 PsiBlast_PDB 77.52100%-141 - C3 -3V8W 7.2 ITK_HUMAN
9 PsiBlast_PDB 77.42100%-135 - C3 -1SM2 8.0 ITK_HUMAN
16 PsiBlast_PDB 77.3798%-133 - C3 -3QGY 7.0 ITK_HUMAN
31 PsiBlast_CBE 77.3699%-141 - C3 -4KIO 6.2 ITK_HUMAN
10 PsiBlast_PDB 77.26100%-131 - C3 -1SNU 7.9 ITK_HUMAN
15 PsiBlast_PDB 77.0898%-137 - C3 -3QGW 5.9 ITK_HUMAN
22 PsiBlast_CBE 77.03100%-136 - C3 -3V8T 6.7
12 PsiBlast_PDB 76.9099%-136 - C3 -4KIO 6.4 ITK_HUMAN
5 PsiBlast_PDB 76.80100%-139 - C3 -3V5J 7.4 ITK_HUMAN
24 PsiBlast_CBE 76.72100%-139 - C3 -3V5L 8.0 ITK_HUMAN
26 PsiBlast_CBE 76.68100%-138 - C3 -1SNU 7.4
52 HHSearch 76.6732%-125 - C3 -2OZO 5.5 ZAP70_HUMAN
7 PsiBlast_PDB 76.10100%-141 - C3 -3V8T 7.0 ITK_HUMAN
27 PsiBlast_CBE 75.84100%-139 - C3 -1SM2 8.5
34 PsiBlast_CBE 75.7498%-132 - C3 -4MF1 6.6
19 PsiBlast_PDB 75.4898%-133 - C3 -4MF1 5.8 ITK_HUMAN
6 PsiBlast_PDB 75.42100%-136 - C3 -3V5L 8.1 ITK_HUMAN
32 PsiBlast_CBE 74.6298%-124 - C3 -3QGY 5.5
33 PsiBlast_CBE 74.4298%-133 - C3 -3QGW 5.3
17 PsiBlast_PDB 74.0598%-137 - C3 -3MJ1 6.8
13 PsiBlast_PDB 72.8699%-133 - C3 -4MF0 6.0 ITK_HUMAN
28 PsiBlast_CBE 71.8399%-133 - C3 -4MF0 -
54 HHSearch 69.4158%-131 - C3 -3GEN 6.5
55 HHSearch 67.8958%-126 - C3 -3SXS 5.4
62 HHSearch 63.9238%-121 * C3 *4AOJ 4.5 NTRK1_HUMAN
68 HHSearch 61.1140%-112 - C3 -1MQB 3.9 EPHA2_HUMAN
65 HHSearch 61.1040%-116 - C3 -3KUL 3.0 EPHA8_HUMAN
36 Fugue 60.8544%-132 - C3 -1BYG 7.7 CSK_HUMAN
60 HHSearch 59.6338%-119 - C3 -4FYO 6.3
57 HHSearch 58.9736%-121 - C3 -1U59 5.8
66 HHSearch 58.8835%-125 - C3 -3POZ 9.4