@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00018_TEC_HU: (2014-08-10 )
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

13J_A_2(4HCV)

[Raw transfer]




13L_A_2(4HCU)

[Raw transfer]




13L_A_2(4HCU)

[Raw transfer]




0G1_A_5(3V5L)
ITK_HUMAN
[Raw transfer]




GOL_A_3(3T9T)

[Raw transfer]




IAQ_A_2(3T9T)

[Raw transfer]




18R_A_2(4HCT)

[Raw transfer]




PP2_A_2(3SXS)

[Raw transfer]




1N1_A_2(3K54)

[Raw transfer]




0F2_A_3(3V5J)
ITK_HUMAN
[Raw transfer]




PP1_B_2(1QCF)
HCK_HUMAN
[Raw transfer]




B43_A_2(3GEN)

[Raw transfer]




B43_A_2(3GEN)

[Raw transfer]




STU_C_3(1SM2)
ITK_HUMAN
[Raw transfer]




STI_A_4(1T46)

[Raw transfer]




04L_A_2(3PJ3)

[Raw transfer]




04K_A_2(3PJ2)

[Raw transfer]




614_A_2(3MJ1)

[Raw transfer]




ANP_A_3(2OZO)
ZAP70_HUMAN
[Raw transfer]




H8H_A_2(2H8H)
SRC_HUMAN
[Raw transfer]




027_A_2(3PIX)

[Raw transfer]




0G2_A_3(3V8W)
ITK_HUMAN
[Raw transfer]




LHL_A_2(3PJ1)

[Raw transfer]




P16_A_3(1OPK)
ABL1_MOUSE
[Raw transfer]




STU_C_3(1SNU)
ITK_HUMAN
[Raw transfer]




STU_A_2(1U59)

[Raw transfer]




GOL_A_5(3KUL)
EPHA8_HUMAN
[Raw transfer]




03C_A_2(3PIZ)

[Raw transfer]




477_A_3(3V8T)
ITK_HUMAN
[Raw transfer]




VGH_A_2(2YFX)

[Raw transfer]




STU_B_2(1BYG)
CSK_HUMAN
[Raw transfer]




03P_A_5(3POZ)

[Raw transfer]




585_A_2(3PIY)

[Raw transfer]




0VF_A_2(4FYO)

[Raw transfer]




V4Z_A_4(4AOJ)
NTRK1_HUMAN
[Raw transfer]




34 HHSearch 95.4442% -99 - C3 -1OPK 10.2 ABL1_MOUSE
32 HHSearch 92.3538%-103 - C3 -1QCF 6.4 HCK_HUMAN
33 HHSearch 91.3239%-100 - C3 -2H8H 8.3 SRC_HUMAN
38 HHSearch 81.6933%-114 - C3 -2OZO 6.0 ZAP70_HUMAN
10 PsiBlast_PDB 79.5566%-120 - C3 -4HCT 9.1
12 PsiBlast_PDB 78.9466%-122 - C3 -4HCV 8.4
40 HHSearch 78.8166%-118 * C3 *4HCU 8.8
4 PsiBlast_PDB 77.8962%-123 - C3 -3PIX 5.7
3 PsiBlast_PDB 77.7966%-121 - C3 -3T9T 6.1
39 HHSearch 77.7462%-126 - C3 -3GEN 8.7
8 PsiBlast_PDB 77.1562%-128 - C3 -3PJ2 7.6
9 PsiBlast_PDB 75.8162%-126 - C3 -3PJ3 10.7
6 PsiBlast_PDB 75.5662%-127 - C3 -3PIZ 7.0
18 PsiBlast_PDB 75.5566%-119 - C3 -3V8T 6.6 ITK_HUMAN
14 PsiBlast_PDB 75.5066%-114 - C3 -1SNU 7.3 ITK_HUMAN
19 PsiBlast_PDB 75.4866%-121 - C3 -3V8W 3.6 ITK_HUMAN
7 PsiBlast_PDB 75.4562%-129 - C3 -3PJ1 7.5
17 PsiBlast_PDB 75.3966%-119 - C3 -3V5L 7.6 ITK_HUMAN
41 HHSearch 75.3060%-117 - C3 -3SXS 7.5
2 PsiBlast_PDB 75.0262%-125 - C3 -3K54 7.4
13 PsiBlast_PDB 74.8966%-117 - C3 -1SM2 7.4 ITK_HUMAN
16 PsiBlast_PDB 74.7466%-122 - C3 -3V5J 6.9 ITK_HUMAN
5 PsiBlast_PDB 74.5562%-119 - C3 -3PIY 7.4
20 PsiBlast_PDB 72.4767%-122 - C3 -3MJ1 6.6
47 HHSearch 67.8635%-107 - C3 -1T46 11.2
48 HHSearch 67.3538%-108 - C3 -4AOJ 6.9 NTRK1_HUMAN
22 Fugue 67.1147%-116 - C3 -1BYG 7.4 CSK_HUMAN
49 HHSearch 65.1940%-105 - C3 -3KUL 3.0 EPHA8_HUMAN
50 HHSearch 64.5640%-101 - C3 -2YFX 6.6
46 HHSearch 64.2336%-111 - C3 -4FYO 7.1
43 HHSearch 62.9636%-109 - C3 -1U59 8.7
52 HHSearch 61.4634%-116 - C3 -3POZ 10.5