@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00026_CARP_Y: (2014-08-11 )
MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI

Atome Classification :

(11 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2Z3_A_2(2JXR)
CARP_YEAST
[Raw transfer]




CAL_G_7(1FQ7)
CARP_YEAST
[Raw transfer]




NLE_F_6(1FQ8)
CARP_YEAST
[Raw transfer]




NME_H_8(1FQ8)
CARP_YEAST
[Raw transfer]




PCE_F_6(1FQ4)
CARP_YEAST
[Raw transfer]




NME_H_8(1FQ7)
CARP_YEAST
[Raw transfer]




CFS_G_7(1FQ8)
CARP_YEAST
[Raw transfer]




LEU_H_8(1FQ5)
CARP_YEAST
[Raw transfer]




XAO_G_7(1FQ6)
CARP_YEAST
[Raw transfer]




STA_G_7(1FQ5)
CARP_YEAST
[Raw transfer]




FMT_A_4(3K1W)
RENI_HUMAN
[Raw transfer]




BAM_A_4(3PVK)
CARP2_CANAX
[Raw transfer]




BFX_A_3(3K1W)
RENI_HUMAN
[Raw transfer]




BAM_A_3(3PVK)
CARP2_CANAX
[Raw transfer]




SMC_E_5(1FQ4)
CARP_YEAST
[Raw transfer]




PHE_E_5(1FQ8)
CARP_YEAST
[Raw transfer]




GSC_F_6(1FQ6)
CARP_YEAST
[Raw transfer]




HIS_F_6(1FQ7)
CARP_YEAST
[Raw transfer]




TRM_D_4(1FQ4)
CARP_YEAST
[Raw transfer]




PHE_E_5(1FQ6)
CARP_YEAST
[Raw transfer]




PHE_E_5(1FQ7)
CARP_YEAST
[Raw transfer]




GLU_F_6(1FQ5)
CARP_YEAST
[Raw transfer]




EMR_G_7(1FQ4)
CARP_YEAST
[Raw transfer]




TRJ_I_9(1FQ5)
CARP_YEAST
[Raw transfer]




SOT_D_4(1FQ6)
CARP_YEAST
[Raw transfer]




NPY_D_4(1FQ5)
CARP_YEAST
[Raw transfer]




BOC_D_4(1FQ7)
CARP_YEAST
[Raw transfer]




MOR_D_4(1FQ8)
CARP_YEAST
[Raw transfer]




MPD_A_5(3PVK)
CARP2_CANAX
[Raw transfer]




EDO_A_7(4AUC)
CHYM_BOVIN
[Raw transfer]




CHAIN_B_2(4AUC)
CHYM_BOVIN
[Raw transfer]

-

CHAIN_I_2(1QRP)
PEPA4_HUMAN
[Raw transfer]

-

CHAIN_I_2(1PSO)
PEPA4_HUMAN
[Raw transfer]

-

8 PsiBlast_PDB 99.4099% -99 - C2 -1FQ6 4.5 CARP_YEAST
5 PsiBlast_PDB 99.2399%-101 - C2 -2JXR 7.2 CARP_YEAST
6 PsiBlast_PDB 99.2099% -99 - C2 -1FQ4 4.5 CARP_YEAST
7 PsiBlast_PDB 99.1899% -98 - C2 -1FQ5 3.2 CARP_YEAST
10 PsiBlast_PDB 98.7799%-101 - C2 -1FQ8 4.6 CARP_YEAST
9 PsiBlast_PDB 98.7399%-101 - C2 -1FQ7 4.9 CARP_YEAST
37 HHSearch 79.8738% -92 - C2 -3K1W 9.1 RENI_HUMAN
16 PsiBlast_PDB 79.0340% -92 - C2 -1QRP 9.4 PEPA4_HUMAN
41 HHSearch 79.0037% -95 * C2 *4AUC 9.4 CHYM_BOVIN
15 PsiBlast_PDB 78.8940% -92 - C2 -1PSO 9.7 PEPA4_HUMAN
50 HHSearch 68.5230% -88 - C2 -3PVK 4.1 CARP2_CANAX