@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00026_CATE_H: (2014-08-11 )
MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSAFATQVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP

Atome Classification :

(12 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0ZL_A_3(1PSA)
PEPA_PIG
[Raw transfer]




BAM_A_4(3PVK)
CARP2_CANAX
[Raw transfer]




IH4_A_2(2BJU)
PLM2_PLAFA
[Raw transfer]




BFX_A_3(3K1W)
RENI_HUMAN
[Raw transfer]




GOL_A_13(4AA9)
?
[Raw transfer]




BAM_A_3(3PVK)
CARP2_CANAX
[Raw transfer]




FMT_A_4(3K1W)
RENI_HUMAN
[Raw transfer]




MPD_C_3(1F34)
PEPA_PIG
[Raw transfer]




CHAIN_B_2(4AUC)
CHYM_BOVIN
[Raw transfer]

-

MPD_A_5(3PVK)
CARP2_CANAX
[Raw transfer]




EOH_B_2(3PEP)
PEPA_PIG
[Raw transfer]




CHAIN_P_2(1CZI)
CHYM_BOVIN
[Raw transfer]

-

EOH_C_3(3PEP)
PEPA_PIG
[Raw transfer]




EDO_A_7(4AUC)
CHYM_BOVIN
[Raw transfer]




CHAIN_I_2(1QRP)
PEPA4_HUMAN
[Raw transfer]

-

CHAIN_I_2(1PSO)
PEPA4_HUMAN
[Raw transfer]

-

CHAIN_I_2(1WKR)
CARP_IRPLA
[Raw transfer]

-

42 HHSearch 82.8056%-118 - C2 -4AUC 9.8 CHYM_BOVIN
15 PsiBlast_PDB 82.3454%-123 - C2 -4AA9 3.1 ?
12 PsiBlast_PDB 82.2756%-114 - C2 -1QRP 9.5 PEPA4_HUMAN
6 PsiBlast_PDB 82.0457%-107 - C2 -1F34 3.5 PEPA_PIG
16 PsiBlast_PDB 81.8652%-118 - C2 -1CZI 7.4 CHYM_BOVIN
11 PsiBlast_PDB 81.6356%-114 - C2 -1PSO 9.5 PEPA4_HUMAN
4 PsiBlast_PDB 80.9657%-114 - C2 -1PSA 9.1 PEPA_PIG
8 PsiBlast_PDB 80.9056%-111 - C2 -3PEP 3.5 PEPA_PIG
36 HHSearch 79.9140%-111 - C2 -3K1W 9.1 RENI_HUMAN
40 HHSearch 71.9131%-102 - C2 -2BJU 9.0 PLM2_PLAFA
51 HHSearch 70.2731% -95 - C2 -1WKR 8.5 CARP_IRPLA
52 HHSearch 68.1930%-102 - C2 -3PVK 4.1 CARP2_CANAX