@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00026_PENP_P: (2014-08-11 )
AASGVATNTPTANDEEYITPVTIGGTTLNLNFDTGSADLWVFSTELPASQQSGHSVYNPSATGKELSGYTWSISYGDGSSASGNVFTDSVTVGGVTAHGQAVQAAQQISAQFQQDTNNDGLLGLAFSSINTVQPQSQTTFFDTVKSSLAQPLFAVALKHQQPGVYDFGFIDSSKYTGSLTYTGVDNSQGFWSFNVDSYTAGSQSGDGFSGIADTGTTLLLLDDSVVSQYYSQVSGAQQDSNAGGYVFDCSTNLPDFSVSISGYTATVPGSLINYGPSGDGSTCLGGIQSNSGIGFSIFGDIFLKSQYVVFDSDGPQLGFAPQA

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PP8_A_7(1BXQ)
PENP_PENJA
[Raw transfer]




0P1_E_2(1PPM)
PENP_PENJA
[Raw transfer]




1Z7_E_2(1PPL)
PENP_PENJA
[Raw transfer]




IHN_C_3(1IZE)
PEPA_ASPNG
[Raw transfer]

-

0EK_E_2(5ER2)
CARP_CRYPA
[Raw transfer]




PP4_A_5(2WEB)
PENP_PENJA
[Raw transfer]




PP6_A_5(2WED)
PENP_PENJA
[Raw transfer]




0ZP_E_2(4ER1)
CARP_CRYPA
[Raw transfer]




0EL_E_2(3ER3)
CARP_CRYPA
[Raw transfer]




IVV_E_2(1PPK)
PENP_PENJA
[Raw transfer]




2ZS_E_2(1EPN)
CARP_CRYPA
[Raw transfer]




0EM_E_2(1ENT)
CARP_CRYPA
[Raw transfer]




0EO_P_2(1EED)
CARP_CRYPA
[Raw transfer]




PP5_A_5(2WEC)
PENP_PENJA
[Raw transfer]




PP6_A_5(2WEA)
PENP_PENJA
[Raw transfer]




0HT_E_2(5ER1)
CARP_CRYPA
[Raw transfer]




DMF_F_6(1APW)
PENP_PENJA
[Raw transfer]




ETH_I_4(1APU)
PENP_PENJA
[Raw transfer]




DMF_E_6(1PPK)
PENP_PENJA
[Raw transfer]




DMF_F_6(1APV)
PENP_PENJA
[Raw transfer]




CHAIN_I_2(1EPM)
CARP_CRYPA
[Raw transfer]

-

CHAIN_I_2(4ER4)
CARP_CRYPA
[Raw transfer]

-

CHAIN_I_2(1APW)
PENP_PENJA
[Raw transfer]

-

CHAIN_I_2(2ER0)
CARP_CRYPA
[Raw transfer]

-

CHAIN_I_2(1APV)
PENP_PENJA
[Raw transfer]

-

CHAIN_I_2(1APU)
PENP_PENJA
[Raw transfer]

-

CHAIN_I_2(3ER5)
CARP_CRYPA
[Raw transfer]

-

CHAIN_I_2(1EPL)
CARP_CRYPA
[Raw transfer]

-

CHAIN_I_2(1ER8)
CARP_CRYPA
[Raw transfer]

-

CHAIN_I_2(1APT)
PENP_PENJA
[Raw transfer]

-

CHAIN_I_2(2ER6)
CARP_CRYPA
[Raw transfer]

-

CHAIN_I_2(2ER9)
CARP_CRYPA
[Raw transfer]

-

CHAIN_I_2(4ER2)
CARP_CRYPA
[Raw transfer]

-

31 PsiBlast_CBE 99.73100%-101 - C5 -1APU 7.1 PENP_PENJA
32 PsiBlast_CBE 99.65100% -99 - C5 -1APT 7.9 PENP_PENJA
30 PsiBlast_CBE 99.49100%-100 - C5 -1APV 7.1 PENP_PENJA
25 PsiBlast_CBE 99.48100%-101 - C5 -1PPM 8.3 PENP_PENJA
27 PsiBlast_CBE 99.45100% -99 - C5 -1PPK 5.5 PENP_PENJA
29 PsiBlast_CBE 99.24100% -99 - C5 -1APW 8.0 PENP_PENJA
23 PsiBlast_CBE 99.20100%-100 - C5 -2WEB 8.4 PENP_PENJA
24 PsiBlast_CBE 99.19100% -98 - C5 -2WEA 6.8 PENP_PENJA
28 PsiBlast_CBE 99.16100% -99 - C5 -1BXQ 9.3 PENP_PENJA
21 PsiBlast_CBE 98.93100% -99 - C5 -2WED 7.4 PENP_PENJA
22 PsiBlast_CBE 98.89100% -98 - C5 -2WEC 7.9 PENP_PENJA
26 PsiBlast_CBE 98.88100% -98 - C5 -1PPL 7.5 PENP_PENJA
3 PsiBlast_PDB 87.9967% -95 - C5 -1IZE 8.9 PEPA_ASPNG
4 PsiBlast_PDB 84.7753% -93 - C5 -1ER8 9.7 CARP_CRYPA
13 PsiBlast_PDB 84.4153% -97 - C5 -4ER4 8.2 CARP_CRYPA
6 PsiBlast_PDB 84.3353% -94 - C5 -2ER6 8.9 CARP_CRYPA
10 PsiBlast_PDB 84.2953% -96 - C5 -3ER5 9.2 CARP_CRYPA
19 PsiBlast_PDB 84.2753% -92 - C5 -1EPM 9.6 CARP_CRYPA
9 PsiBlast_PDB 84.2753% -95 - C5 -3ER3 7.4 CARP_CRYPA
11 PsiBlast_PDB 84.0953% -93 - C5 -4ER1 9.7 CARP_CRYPA
18 PsiBlast_PDB 84.0853% -92 - C5 -1EPL 8.8 CARP_CRYPA
17 PsiBlast_PDB 84.0853% -93 - C5 -1ENT 5.9 CARP_CRYPA
8 PsiBlast_PDB 84.0253% -93 - C5 -2ER9 8.9 CARP_CRYPA
16 PsiBlast_PDB 84.0053% -96 - C5 -1EED 5.2 CARP_CRYPA
5 PsiBlast_PDB 83.8953% -93 - C5 -2ER0 9.1 CARP_CRYPA
15 PsiBlast_PDB 83.7853% -92 - C5 -5ER2 7.3 CARP_CRYPA
12 PsiBlast_PDB 83.5253% -91 - C5 -4ER2 8.9 CARP_CRYPA
14 PsiBlast_PDB 83.5153% -94 - C5 -5ER1 6.2 CARP_CRYPA
20 PsiBlast_PDB 83.3753% -93 - C5 -1EPN 5.9 CARP_CRYPA