@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00026_PLM2_P: (2014-08-11 )
SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYTASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEERFYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDVIKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPVPTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IHN_C_3(1M43)
PLM2_PLAFA
[Raw transfer]

-

IHN_C_4(1W6I)
PLM2_PLAFA
[Raw transfer]

-

IHN_A_3(1SME)
PLM2_PLAFA
[Raw transfer]

-

IHN_D_4(1XDH)
PLM2_PLAFA
[Raw transfer]

-

IHN_B_4(1SME)
PLM2_PLAFA
[Raw transfer]

-

IHN_C_3(1XDH)
PLM2_PLAFA
[Raw transfer]

-

IHN_A_3(1W6I)
PLM2_PLAFA
[Raw transfer]

-

TIT_A_3(1W6H)
PLM2_PLAFA
[Raw transfer]




R36_B_2(1LEE)
PLM2_PLAFA
[Raw transfer]




TIT_B_4(1W6H)
PLM2_PLAFA
[Raw transfer]




IVS_D_4(1ME6)
PLM2_PLAFA
[Raw transfer]




IHN_C_3(1LS5)
?
[Raw transfer]

-

R37_B_2(1LF2)
PLM2_PLAFA
[Raw transfer]




IVS_C_3(1ME6)
PLM2_PLAFA
[Raw transfer]




JE2_D_4(2ANL)
?
[Raw transfer]




JE2_C_3(2ANL)
?
[Raw transfer]




A2T_D_4(2IGY)
PLM2_PLAFA
[Raw transfer]




IH4_A_2(2BJU)
PLM2_PLAFA
[Raw transfer]




A2T_C_3(2IGY)
PLM2_PLAFA
[Raw transfer]




A1T_A_2(2IGX)
PLM2_PLAFA
[Raw transfer]




IH4_A_3(2BJU)
PLM2_PLAFA
[Raw transfer]




CHAIN_C_3(1QS8)
?
[Raw transfer]

-

CHAIN_D_4(2R9B)
PLM2_PLAFA
[Raw transfer]

-

CHAIN_C_2(2R9B)
PLM2_PLAFA
[Raw transfer]

-

CHAIN_D_4(2R9B)
PLM2_PLAFA
[Raw transfer]

-

CHAIN_C_2(2R9B)
PLM2_PLAFA
[Raw transfer]

-

7 PsiBlast_PDB 98.25100%-126 - C6 -2IGY 9.7 PLM2_PLAFA
24 PsiBlast_CBE 98.21100%-128 - C6 -2IGY 10.1 PLM2_PLAFA
11 PsiBlast_PDB 97.86100%-127 - C6 -1XDH 9.7 PLM2_PLAFA
21 PsiBlast_CBE 97.85100%-129 - C6 -2BJU 10.7 PLM2_PLAFA
29 PsiBlast_CBE 97.82100%-125 - C6 -1XDH 9.8 PLM2_PLAFA
13 PsiBlast_PDB 97.60100%-128 - C6 -1W6I 9.4 PLM2_PLAFA
6 PsiBlast_PDB 97.60100%-130 - C6 -2IGX 11.5 PLM2_PLAFA
8 PsiBlast_PDB 97.50100%-125 - C6 -2R9B 10.6 PLM2_PLAFA
3 PsiBlast_PDB 97.46100%-127 - C6 -1ME6 7.0 PLM2_PLAFA
16 PsiBlast_PDB 97.1199%-118 - C6 -1LF2 8.2 PLM2_PLAFA
12 PsiBlast_PDB 97.10100%-125 - C6 -1W6H 9.5 PLM2_PLAFA
15 PsiBlast_PDB 96.9999%-119 - C6 -1LEE 8.8 PLM2_PLAFA
31 PsiBlast_CBE 96.81100%-127 - C6 -1W6H 9.0 PLM2_PLAFA
30 PsiBlast_CBE 96.62100%-121 - C6 -1W6I 9.5 PLM2_PLAFA
23 PsiBlast_CBE 96.47100%-124 - C6 -2R9B 11.0 PLM2_PLAFA
28 PsiBlast_CBE 96.46100%-119 - C6 -1ME6 8.0 PLM2_PLAFA
32 PsiBlast_CBE 96.4499%-124 - C6 -1M43 - PLM2_PLAFA
14 PsiBlast_PDB 96.2899%-126 - C6 -1M43 9.2 PLM2_PLAFA
2 PsiBlast_PDB 96.04100%-122 - C6 -1SME 10.6 PLM2_PLAFA
27 PsiBlast_CBE 95.98100%-119 - C6 -1SME 10.3 PLM2_PLAFA
37 PsiBlast_CBE 89.2971%-122 - C6 -1QS8 - ?
38 PsiBlast_CBE 89.1271%-119 - C6 -1QS8 7.4 ?
36 PsiBlast_CBE 87.2471%-127 - C6 -2ANL 4.6 ?
19 PsiBlast_PDB 87.2271%-127 - C6 -2ANL 4.9 ?
20 PsiBlast_PDB 86.4569%-121 - C6 -1LS5 5.5 ?