@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00069_KAPCA_: (2014-08-16 )
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2PY_C_3(2OH0)
KAPCA_BOVIN
[Raw transfer]




2EA_C_3(2F7E)
KAPCA_BOVIN
[Raw transfer]




4PY_C_3(2OJF)
KAPCA_BOVIN
[Raw transfer]




IQB_A_3(3VQH)
KAPCA_HUMAN
[Raw transfer]




4EA_C_3(2F7X)
KAPCA_BOVIN
[Raw transfer]




6EA_C_3(2F7Z)
KAPCA_BOVIN
[Raw transfer]




A67_A_2(3AGM)
KAPCA_HUMAN
[Raw transfer]

-

3SB_A_3(3OXT)
KAPCA_HUMAN
[Raw transfer]




I5S_A_3(2C1A)
KAPCA_BOVIN
[Raw transfer]




GOL_A_4(4IE9)
KAPCA_BOVIN
[Raw transfer]




A03_B_4(3AGL)
KAPCA_HUMAN
[Raw transfer]




2SB_A_3(3OWP)
KAPCA_HUMAN
[Raw transfer]




S69_A_3(3POO)
KAPCA_HUMAN
[Raw transfer]




1SB_A_3(3OVV)
KAPCA_HUMAN
[Raw transfer]




L9M_A_5(3L9M)
KAPCA_HUMAN
[Raw transfer]




4SB_A_3(3P0M)
KAPCA_HUMAN
[Raw transfer]




GOL_A_10(3ZO3)
KAPCA_BOVIN
[Raw transfer]




ANP_A_7(1CDK)
KAPCA_PIG
[Raw transfer]




A03_A_3(3AGL)
KAPCA_HUMAN
[Raw transfer]




QWI_A_4(3ZO4)
KAPCA_BOVIN
[Raw transfer]




ANP_B_11(1CDK)
KAPCA_PIG
[Raw transfer]




ANP_A_7(1CDK)
KAPCA_PIG
[Raw transfer]




CQP_A_3(2C1B)
KAPCA_BOVIN
[Raw transfer]




R94_C_3(1XH6)
KAPCA_BOVIN
[Raw transfer]




R68_C_3(1XH5)
KAPCA_BOVIN
[Raw transfer]




XFE_A_7(3MVJ)
KAPCA_HUMAN
[Raw transfer]




M05_A_4(2VO7)
KAPCA_BOVIN
[Raw transfer]




I08_C_3(1SVH)
KAPCA_BOVIN
[Raw transfer]




L20_A_3(2JDV)
KAPCA_BOVIN
[Raw transfer]




L9N_A_3(3L9N)
KAPCA_HUMAN
[Raw transfer]




IQB_E_3(1YDT)
KAPCA_BOVIN
[Raw transfer]




ANP_A_4(2R5T)
SGK1_HUMAN
[Raw transfer]




R55_C_3(1XH8)
KAPCA_BOVIN
[Raw transfer]




L9M_B_6(3L9M)
KAPCA_HUMAN
[Raw transfer]




ATP_A_4(1Q24)
KAPCA_BOVIN
[Raw transfer]




I5S_A_3(2JDT)
KAPCA_BOVIN
[Raw transfer]




L9L_A_5(3L9L)
KAPCA_HUMAN
[Raw transfer]




RKD_A_3(4AXA)
KAPCA_BOVIN
[Raw transfer]




82B_A_2(4BKY)
MELK_HUMAN
[Raw transfer]




GVP_A_3(2UW7)
KAPCA_BOVIN
[Raw transfer]




L15_A_3(2UW4)
KAPCA_BOVIN
[Raw transfer]




0XZ_A_2(4GV1)
AKT1_HUMAN
[Raw transfer]




HFS_C_3(2ERZ)
KAPCA_MOUSE
[Raw transfer]




ANP_B_7(3O7L)
KAPCA_MOUSE
[Raw transfer]




PTV_A_3(4IJ9)
KAPCA_BOVIN
[Raw transfer]




L9L_B_6(3L9L)
KAPCA_HUMAN
[Raw transfer]




PZX_A_3(4IE9)
KAPCA_BOVIN
[Raw transfer]




Y27_C_3(2GNJ)
KAPCA_BOVIN
[Raw transfer]




IQS_C_3(1YDS)
KAPCA_BOVIN
[Raw transfer]




07U_A_2(3TXO)

[Raw transfer]




LL1_A_3(3DNE)
KAPCA_BOVIN
[Raw transfer]




YTP_A_3(3OOG)
KAPCA_HUMAN
[Raw transfer]




H52_C_3(2GNL)
KAPCA_BOVIN
[Raw transfer]




IQP_C_3(1YDR)
KAPCA_BOVIN
[Raw transfer]




GVH_A_3(2UVX)
KAPCA_BOVIN
[Raw transfer]




LL2_A_3(3DND)
KAPCA_BOVIN
[Raw transfer]




XFE_E_8(3MVJ)
KAPCA_HUMAN
[Raw transfer]




QNI_A_3(3ZO3)
KAPCA_BOVIN
[Raw transfer]




SIJ_A_3(3ZO1)
KAPCA_BOVIN
[Raw transfer]




ADE_A_3(4DC2)
KPCI_MOUSE
[Raw transfer]




PEG_B_6(3O7L)
KAPCA_MOUSE
[Raw transfer]




CHAIN_I_3(1CTP)
KAPCA_PIG
[Raw transfer]

-

SL0_A_2(3UBD)
KS6A3_MOUSE
[Raw transfer]




BUD_A_4(3POO)
KAPCA_HUMAN
[Raw transfer]




BUD_B_4(3OVV)
KAPCA_HUMAN
[Raw transfer]




CHAIN_B_2(3VQH)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OXT)
KAPCA_HUMAN
[Raw transfer]

-

MPD_A_4(3VQH)
KAPCA_HUMAN
[Raw transfer]




CHAIN_B_2(3POO)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OOG)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OVV)
KAPCA_HUMAN
[Raw transfer]

-

MPD_A_3(3ZO4)
KAPCA_BOVIN
[Raw transfer]




CHAIN_C_2(3L9M)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2C1A)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(3OWP)
KAPCA_HUMAN
[Raw transfer]

-

0R4_A_2(4EJN)
AKT1_HUMAN
[Raw transfer]




CHAIN_I_2(2OH0)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2F7E)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2CPK)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_I_2(2VO7)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2F7X)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_C_2(3L9N)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2OJF)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(3ZO4)
KAPCA_BOVIN
[Raw transfer]

-

MOH_A_14(3ZO3)
KAPCA_BOVIN
[Raw transfer]




CHAIN_B_2(3P0M)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2C1B)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_C_2(3L9L)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(4IE9)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2F7Z)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(3DNE)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2GNL)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(1YDT)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(1XH8)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(1CDK)
KAPCA_PIG
[Raw transfer]

-

CHAIN_I_2(2UVX)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_3(3O7L)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_D_4(3L9L)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(3ZO1)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(1YDR)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_D_4(3L9M)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(4AXA)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2GNJ)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(1Q61)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(3DND)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(1Q62)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2JDT)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2UW4)
KAPCA_BOVIN
[Raw transfer]

-

TYI_I_9(1CTP)
KAPCA_PIG
[Raw transfer]




CHAIN_I_2(2GFC)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(1YDS)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2ERZ)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_J_4(1CDK)
KAPCA_PIG
[Raw transfer]

-

CHAIN_I_2(3ZO3)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(4IJ9)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2UW7)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(1XH6)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(1Q24)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2JDV)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(1SVH)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(1XH5)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_4(3MVJ)
KAPCA_HUMAN
[Raw transfer]

-

EDO_A_8(4DN5)
M3K14_HUMAN
[Raw transfer]




CHAIN_I_2(1CMK)
KAPCA_PIG
[Raw transfer]

-

11 PsiBlast_PDB 93.3099% -95 - C1 -3VQH 9.9 KAPCA_HUMAN
23 PsiBlast_CBE 93.1399%-107 - C1 -2F7Z 7.7 KAPCA_BOVIN
6 PsiBlast_PDB 93.1199%-101 - C1 -3OWP 10.5 KAPCA_HUMAN
7 PsiBlast_PDB 93.0499%-102 - C1 -3OXT 9.0 KAPCA_HUMAN
8 PsiBlast_PDB 92.9599%-101 - C1 -3P0M 9.2 KAPCA_HUMAN
5 PsiBlast_PDB 92.6299%-101 - C1 -3OVV 9.9 KAPCA_HUMAN
16 PsiBlast_PDB 92.5698%-102 - C1 -3ZO4 9.9 KAPCA_BOVIN
14 PsiBlast_PDB 92.5298%-102 - C1 -2VO7 9.4 KAPCA_BOVIN
13 PsiBlast_PDB 92.3398%-103 - C1 -2C1B 11.5 KAPCA_BOVIN
21 PsiBlast_CBE 92.2099%-102 - C1 -2OJF 7.8 KAPCA_BOVIN
17 PsiBlast_PDB 92.0898%-101 - C1 -4IE9 9.0 KAPCA_BOVIN
3 PsiBlast_PDB 91.8599%-100 - C1 -3L9L 8.8 KAPCA_HUMAN
2 PsiBlast_PDB 91.6999%-100 - C1 -3AGM 9.0 KAPCA_HUMAN
4 PsiBlast_PDB 91.6699%-101 - C1 -3OOG 8.3 KAPCA_HUMAN
24 PsiBlast_CBE 91.6299%-100 - C1 -2F7X 7.9 KAPCA_BOVIN
9 PsiBlast_PDB 91.6299%-102 - C1 -3POO 10.4 KAPCA_HUMAN
12 PsiBlast_PDB 91.5198%-102 - C1 -2C1A 10.1 KAPCA_BOVIN
25 PsiBlast_CBE 91.4399%-102 - C1 -2F7E 9.0 KAPCA_BOVIN
20 PsiBlast_PDB 91.3198%-110 - C1 -1CTP 7.0 KAPCA_PIG
22 PsiBlast_CBE 91.0199%-103 - C1 -2OH0 7.7 KAPCA_BOVIN
29 PsiBlast_CBE 90.9098%-101 - C1 -2CPK 8.8 KAPCA_MOUSE
10 PsiBlast_PDB 90.8199% -96 - C1 -3AGL 9.8 KAPCA_HUMAN
19 PsiBlast_PDB 90.6098%-106 - C1 -3L9N 8.5 KAPCA_HUMAN
18 PsiBlast_PDB 90.4398%-101 - C1 -3L9M 8.6 KAPCA_HUMAN
1 PsiBlast_PDB 89.1999% -97 - C1 -3MVJ 5.0 KAPCA_HUMAN
65 Fugue 77.6890% -99 - C1 -1CDK 8.1 KAPCA_PIG
30 PsiBlast_CBE 66.7498% -59 - C1 -1CDK 8.0 KAPCA_PIG
40 PsiBlast_CBE 63.3398% -60 - C1 -3DNE 5.4 KAPCA_BOVIN
35 PsiBlast_CBE 62.9998% -59 - C1 -1XH8 10.9 KAPCA_BOVIN
37 PsiBlast_CBE 62.6398% -58 - C1 -1XH5 9.8 KAPCA_BOVIN
27 PsiBlast_CBE 62.3199% -60 - C1 -3MVJ 4.6 KAPCA_HUMAN
33 PsiBlast_CBE 62.2698% -59 - C1 -4IJ9 6.4 KAPCA_BOVIN
42 PsiBlast_CBE 62.1398% -54 - C1 -1CMK 3.3 KAPCA_PIG
53 PsiBlast_CBE 62.0898% -57 - C1 -2GNL 4.5 KAPCA_BOVIN
34 PsiBlast_CBE 61.9698% -59 - C1 -2GFC 5.7 KAPCA_BOVIN
41 PsiBlast_CBE 61.9098% -59 - C1 -3DND 5.7 KAPCA_BOVIN
26 PsiBlast_CBE 61.8299% -59 - C1 -3L9L 7.6 KAPCA_HUMAN
55 PsiBlast_CBE 61.7998% -58 - C1 -1YDT 6.8 KAPCA_BOVIN
43 PsiBlast_CBE 61.7498% -61 - C1 -1Q62 6.7 KAPCA_BOVIN
58 PsiBlast_CBE 61.6397% -56 - C1 -2ERZ 4.1 KAPCA_MOUSE
54 PsiBlast_CBE 61.5398% -57 - C1 -2GNJ 5.8 KAPCA_BOVIN
56 PsiBlast_CBE 61.0498% -58 - C1 -1YDS 4.9 KAPCA_BOVIN
44 PsiBlast_CBE 61.0398% -59 - C1 -1Q24 6.5 KAPCA_BOVIN
38 PsiBlast_CBE 60.9498% -57 - C1 -1SVH 9.6 KAPCA_BOVIN
51 PsiBlast_CBE 60.9397% -58 - C1 -2JDT 6.7 KAPCA_BOVIN
46 PsiBlast_CBE 60.8797% -59 - C1 -4AXA 5.8 KAPCA_BOVIN
49 PsiBlast_CBE 60.7997% -60 - C1 -2UVX 6.1 KAPCA_BOVIN
50 PsiBlast_CBE 60.7797% -61 - C1 -2JDV 7.0 KAPCA_BOVIN
39 PsiBlast_CBE 60.7199% -58 - C1 -3AGL 8.9 KAPCA_HUMAN
47 PsiBlast_CBE 60.6197% -57 - C1 -2UW7 6.6 KAPCA_BOVIN
48 PsiBlast_CBE 60.2697% -57 - C1 -2UW4 5.7 KAPCA_BOVIN
45 PsiBlast_CBE 60.1997% -62 - C1 -3O7L 5.6 KAPCA_MOUSE
36 PsiBlast_CBE 59.6598% -58 - C1 -1XH6 9.9 KAPCA_BOVIN
57 PsiBlast_CBE 59.5298% -57 - C1 -1YDR 5.0 KAPCA_BOVIN
52 PsiBlast_CBE 59.3898% -58 - C1 -1Q61 4.3 KAPCA_BOVIN
32 PsiBlast_CBE 59.2198% -58 - C1 -3L9M 6.3 KAPCA_HUMAN
28 PsiBlast_CBE 59.1399% -65 - C1 -3MVJ - KAPCA_HUMAN
72 HHSearch 56.8344%-104 - C1 -4GV1 7.5 AKT1_HUMAN
59 PsiBlast_CBE 56.5198% -39 - C1 -3ZO3 6.4 KAPCA_BOVIN
82 HHSearch 56.0939% -97 - C1 -4DC2 3.2 KPCI_MOUSE
89 HHSearch 55.9545%-110 - C1 -4EJN 6.1 AKT1_HUMAN
60 PsiBlast_CBE 55.9498% -38 - C1 -3ZO1 3.5 KAPCA_BOVIN
76 HHSearch 52.6743%-113 - C1 -2R5T 7.0 SGK1_HUMAN
75 HHSearch 49.5142% -96 - C1 -3TXO 5.8
95 HHSearch 43.5840%-108 - C1 -3UBD 4.8 KS6A3_MOUSE
94 HHSearch 40.8536%-113 * C1 *4BKY 8.0 MELK_HUMAN