@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00069_KAPCA_: (2014-08-16 )
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWEDPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2PY_C_3(2OH0)
KAPCA_BOVIN
[Raw transfer]




2EA_C_3(2F7E)
KAPCA_BOVIN
[Raw transfer]




4PY_C_3(2OJF)
KAPCA_BOVIN
[Raw transfer]




4EA_C_3(2F7X)
KAPCA_BOVIN
[Raw transfer]




A67_A_2(3AGM)
KAPCA_HUMAN
[Raw transfer]




IQB_A_3(3VQH)
KAPCA_HUMAN
[Raw transfer]




6EA_C_3(2F7Z)
KAPCA_BOVIN
[Raw transfer]




1SB_A_3(3OVV)
KAPCA_HUMAN
[Raw transfer]




I5S_A_3(2C1A)
KAPCA_BOVIN
[Raw transfer]




ANP_B_11(1CDK)
KAPCA_PIG
[Raw transfer]




3SB_A_3(3OXT)
KAPCA_HUMAN
[Raw transfer]




S69_A_3(3POO)
KAPCA_HUMAN
[Raw transfer]




L9M_A_5(3L9M)
KAPCA_HUMAN
[Raw transfer]




2SB_A_3(3OWP)
KAPCA_HUMAN
[Raw transfer]




A03_A_3(3AGL)
KAPCA_HUMAN
[Raw transfer]




4SB_A_3(3P0M)
KAPCA_HUMAN
[Raw transfer]




ANP_A_7(1CDK)
KAPCA_PIG
[Raw transfer]




R94_C_3(1XH6)
KAPCA_BOVIN
[Raw transfer]




B1L_B_2(1REJ)
KAPCA_MOUSE
[Raw transfer]




I08_C_3(1SVH)
KAPCA_BOVIN
[Raw transfer]




GOL_A_4(4IE9)
KAPCA_BOVIN
[Raw transfer]




HFS_C_3(2ERZ)
KAPCA_MOUSE
[Raw transfer]




CQP_A_3(2C1B)
KAPCA_BOVIN
[Raw transfer]




ANP_A_4(2R5T)
SGK1_HUMAN
[Raw transfer]




ATP_E_5(3FJQ)
KAPCA_MOUSE
[Raw transfer]




B8L_B_2(1REK)
KAPCA_MOUSE
[Raw transfer]




R55_C_3(1XH8)
KAPCA_BOVIN
[Raw transfer]




R68_C_3(1XH5)
KAPCA_BOVIN
[Raw transfer]




XFE_A_7(3MVJ)
KAPCA_HUMAN
[Raw transfer]




BD2_B_2(1RE8)
KAPCA_MOUSE
[Raw transfer]




ATP_E_3(3QAM)
KAPCA_MOUSE
[Raw transfer]




ANP_A_3(3FHI)
KAPCA_MOUSE
[Raw transfer]




M05_A_4(2VO7)
KAPCA_BOVIN
[Raw transfer]




L9M_B_6(3L9M)
KAPCA_HUMAN
[Raw transfer]




L9N_A_3(3L9N)
KAPCA_HUMAN
[Raw transfer]




ATP_E_3(3QAL)
KAPCA_MOUSE
[Raw transfer]




ATP_E_5(1ATP)
KAPCA_MOUSE
[Raw transfer]




ANP_B_7(3O7L)
KAPCA_MOUSE
[Raw transfer]




QWI_A_4(3ZO4)
KAPCA_BOVIN
[Raw transfer]




L9L_A_5(3L9L)
KAPCA_HUMAN
[Raw transfer]




SMY_A_3(3OW3)
KAPCA_MOUSE
[Raw transfer]




ANP_E_3(4HPT)
KAPCA_MOUSE
[Raw transfer]




ATP_A_3(4DIN)
KAPCA_MOUSE
[Raw transfer]




ANP_A_5(3IDB)
KAPCA_MOUSE
[Raw transfer]




82B_A_2(4BKY)
MELK_HUMAN
[Raw transfer]




ADP_A_5(4IB1)
KAPCA_MOUSE
[Raw transfer]




ANP_A_5(3IDC)
KAPCA_MOUSE
[Raw transfer]




L9L_B_6(3L9L)
KAPCA_HUMAN
[Raw transfer]




ADN_C_3(1FMO)
KAPCA_MOUSE
[Raw transfer]




0XZ_A_2(4GV1)
AKT1_HUMAN
[Raw transfer]




PTV_A_3(4IJ9)
KAPCA_BOVIN
[Raw transfer]




ANP_E_3(4DG3)
KAPCA_MOUSE
[Raw transfer]




YTP_A_3(3OOG)
KAPCA_HUMAN
[Raw transfer]




07U_A_2(3TXO)

[Raw transfer]




ADP_A_3(4IB3)
KAPCA_MOUSE
[Raw transfer]




PZX_A_3(4IE9)
KAPCA_BOVIN
[Raw transfer]




ADP_B_3(2QUR)
KAPCA_MOUSE
[Raw transfer]




XFE_E_8(3MVJ)
KAPCA_HUMAN
[Raw transfer]




ADE_A_3(4DC2)
KPCI_MOUSE
[Raw transfer]




PEG_B_6(3O7L)
KAPCA_MOUSE
[Raw transfer]




SL0_A_2(3UBD)
KS6A3_MOUSE
[Raw transfer]




CHAIN_I_3(1CTP)
KAPCA_PIG
[Raw transfer]

-

BUD_A_4(3POO)
KAPCA_HUMAN
[Raw transfer]




BUD_B_4(3OVV)
KAPCA_HUMAN
[Raw transfer]




BU3_D_4(1XH5)
KAPCA_BOVIN
[Raw transfer]




CHAIN_B_2(3OOG)
KAPCA_HUMAN
[Raw transfer]

-

MPD_A_4(3VQH)
KAPCA_HUMAN
[Raw transfer]




CHAIN_B_2(3OXT)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2F7X)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_C_2(3L9N)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2C1A)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2VO7)
KAPCA_BOVIN
[Raw transfer]

-

0R4_A_2(4EJN)
AKT1_HUMAN
[Raw transfer]




CHAIN_I_2(2C1B)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(1CDK)
KAPCA_PIG
[Raw transfer]

-

CHAIN_C_2(3L9M)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2ERZ)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_C_2(3L9L)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2OJF)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2CPK)
KAPCA_MOUSE
[Raw transfer]

-

MPD_A_3(3ZO4)
KAPCA_BOVIN
[Raw transfer]




CHAIN_B_2(3OWP)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OVV)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_B_2(3POO)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2OH0)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(3VQH)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2F7E)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(2F7Z)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(3P0M)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(3ZO4)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_S_2(1JLU)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_I_2(1FMO)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_J_5(3MVJ)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(1ATP)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_I_2(3FJQ)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_I_2(3QAM)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_B_2(1XH8)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_2(4HPT)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_I_2(4IE9)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_S_2(4IB3)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_S_2(4IB1)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_I_3(3O7L)
KAPCA_MOUSE
[Raw transfer]

-

TYI_I_9(1CTP)
KAPCA_PIG
[Raw transfer]




CHAIN_J_4(1CDK)
KAPCA_PIG
[Raw transfer]

-

CHAIN_D_4(3L9M)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(4IJ9)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_D_4(3L9L)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OW3)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_I_4(3MVJ)
KAPCA_HUMAN
[Raw transfer]

-

CHAIN_I_2(2GFC)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(2QUR)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_I_2(3QAL)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_B_2(1XH6)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_A_2(4DG3)
KAPCA_MOUSE
[Raw transfer]

-

CHAIN_B_2(1XH5)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_B_2(1SVH)
KAPCA_BOVIN
[Raw transfer]

-

CHAIN_I_3(3O7L)
KAPCA_MOUSE
[Raw transfer]

-

24 PsiBlast_CBE 93.2897%-107 - C1 -2F7Z 7.7 KAPCA_BOVIN
1 PsiBlast_PDB 92.4298%-103 - C1 -2ERZ 7.7 KAPCA_MOUSE
10 PsiBlast_PDB 92.3497%-102 - C1 -3OWP 10.5 KAPCA_HUMAN
17 PsiBlast_PDB 92.3096%-100 - C1 -1CDK 11.3 KAPCA_PIG
19 PsiBlast_PDB 92.2097%-104 - C1 -2C1B 11.5 KAPCA_BOVIN
20 PsiBlast_PDB 92.0997%-103 - C1 -2VO7 9.4 KAPCA_BOVIN
11 PsiBlast_PDB 92.0897%-101 - C1 -3OXT 9.0 KAPCA_HUMAN
22 PsiBlast_CBE 91.9797%-102 - C1 -2OJF 7.8 KAPCA_BOVIN
12 PsiBlast_PDB 91.6697%-102 - C1 -3P0M 9.2 KAPCA_HUMAN
25 PsiBlast_CBE 91.4897%-101 - C1 -2F7X 7.9 KAPCA_BOVIN
16 PsiBlast_PDB 91.4797% -96 - C1 -3VQH 9.9 KAPCA_HUMAN
23 PsiBlast_CBE 91.3797%-104 - C1 -2OH0 7.7 KAPCA_BOVIN
9 PsiBlast_PDB 91.3797%-101 - C1 -3OVV 9.9 KAPCA_HUMAN
26 PsiBlast_CBE 91.1597%-102 - C1 -2F7E 9.0 KAPCA_BOVIN
18 PsiBlast_PDB 91.1497%-102 - C1 -2C1A 10.1 KAPCA_BOVIN
21 PsiBlast_CBE 90.9799%-101 - C1 -2CPK 8.8 KAPCA_MOUSE
8 PsiBlast_PDB 90.8297%-102 - C1 -3OOG 8.3 KAPCA_HUMAN
7 PsiBlast_PDB 90.7197%-100 - C1 -3L9L 8.8 KAPCA_HUMAN
13 PsiBlast_PDB 90.6997%-103 - C1 -3POO 10.4 KAPCA_HUMAN
6 PsiBlast_PDB 90.5797%-100 - C1 -3AGM 9.0 KAPCA_HUMAN
14 PsiBlast_PDB 89.7797%-110 - C1 -1CTP 7.0 KAPCA_PIG
5 PsiBlast_PDB 89.4696%-106 - C1 -3L9N 8.5 KAPCA_HUMAN
15 PsiBlast_PDB 89.4597% -95 - C1 -3AGL 9.8 KAPCA_HUMAN
4 PsiBlast_PDB 88.9596%-101 - C1 -3L9M 8.6 KAPCA_HUMAN
3 PsiBlast_PDB 88.7397% -97 - C1 -3MVJ 5.0 KAPCA_HUMAN
46 PsiBlast_CBE 65.6696% -59 - C1 -1CDK 8.0 KAPCA_PIG
38 PsiBlast_CBE 65.0298% -62 - C1 -1JLU 4.6 KAPCA_MOUSE
39 PsiBlast_CBE 64.5998% -60 - C1 -1FMO 4.6 KAPCA_MOUSE
47 PsiBlast_CBE 63.5898% -56 - C1 -3QAL 8.3 KAPCA_MOUSE
42 PsiBlast_CBE 63.3698% -54 - C1 -3QAM 7.1 KAPCA_MOUSE
32 PsiBlast_CBE 63.3398% -55 - C1 -3IDC 5.4 KAPCA_MOUSE
30 PsiBlast_CBE 63.1298% -61 - C1 -3OW3 6.3 KAPCA_MOUSE
37 PsiBlast_CBE 63.0298% -61 - C1 -1RE8 8.5 KAPCA_MOUSE
50 PsiBlast_CBE 62.8997% -61 - C1 -3ZO4 7.4 KAPCA_BOVIN
35 PsiBlast_CBE 62.8598% -63 - C1 -1REK 10.8 KAPCA_MOUSE
57 PsiBlast_CBE 62.6397% -58 - C1 -1XH5 9.8 KAPCA_BOVIN
28 PsiBlast_CBE 62.6198% -58 - C1 -4HPT 6.7 KAPCA_MOUSE
44 PsiBlast_CBE 62.5397% -61 - C1 -3MVJ 4.6 KAPCA_HUMAN
55 PsiBlast_CBE 62.5097% -59 - C1 -1XH8 10.9 KAPCA_BOVIN
53 PsiBlast_CBE 62.4797% -59 - C1 -4IJ9 6.4 KAPCA_BOVIN
54 PsiBlast_CBE 62.4197% -59 - C1 -2GFC 5.7 KAPCA_BOVIN
33 PsiBlast_CBE 62.3398% -55 - C1 -3IDB 6.5 KAPCA_MOUSE
29 PsiBlast_CBE 62.1498% -57 - C1 -4DIN 6.7 KAPCA_MOUSE
51 PsiBlast_CBE 62.0498% -62 - C1 -2QUR 4.4 KAPCA_MOUSE
49 PsiBlast_CBE 61.6197% -59 - C1 -4IE9 5.9 KAPCA_BOVIN
31 PsiBlast_CBE 61.5898% -62 - C1 -3O7L 2.8 KAPCA_MOUSE
43 PsiBlast_CBE 61.3597% -59 - C1 -3L9L 7.6 KAPCA_HUMAN
58 PsiBlast_CBE 61.2697% -57 - C1 -1SVH 9.6 KAPCA_BOVIN
27 PsiBlast_CBE 61.2398% -63 - C1 -3O7L 5.6 KAPCA_MOUSE
40 PsiBlast_CBE 61.1998% -57 - C1 -1ATP 7.6 KAPCA_MOUSE
34 PsiBlast_CBE 61.1898% -59 - C1 -3FJQ 8.5 KAPCA_MOUSE
48 PsiBlast_CBE 61.1298% -56 - C1 -3FHI 8.0 KAPCA_MOUSE
36 PsiBlast_CBE 60.0898% -62 - C1 -1REJ 6.6 KAPCA_MOUSE
56 PsiBlast_CBE 59.8897% -58 - C1 -1XH6 9.9 KAPCA_BOVIN
52 PsiBlast_CBE 59.6696% -58 - C1 -3L9M 6.3 KAPCA_HUMAN
45 PsiBlast_CBE 59.1597% -66 - C1 -3MVJ 4.1 KAPCA_HUMAN
82 HHSearch 55.8739% -97 - C1 -4DC2 3.2 KPCI_MOUSE
72 HHSearch 55.7843%-105 - C1 -4GV1 7.5 AKT1_HUMAN
59 PsiBlast_CBE 55.5298% -38 - C1 -4IB3 5.9 KAPCA_MOUSE
41 PsiBlast_CBE 54.7198% -39 - C1 -4DG3 5.7 KAPCA_MOUSE
89 HHSearch 54.6244%-111 - C1 -4EJN 6.1 AKT1_HUMAN
60 PsiBlast_CBE 54.6198% -39 - C1 -4IB1 5.1 KAPCA_MOUSE
76 HHSearch 51.4743%-114 - C1 -2R5T 7.0 SGK1_HUMAN
75 HHSearch 48.9542% -96 - C1 -3TXO 5.8
96 HHSearch 42.3739%-108 - C1 -3UBD 4.8 KS6A3_MOUSE
94 HHSearch 39.1135%-114 * C1 *4BKY 8.0 MELK_HUMAN