@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00071_CDC42_: (2014-08-20 )
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

Atome Classification :

(60 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GNP_A_3(3TH5)
RAC1_HUMAN
[Raw transfer]




GNP_A_5(3EG5)
CDC42_MOUSE
[Raw transfer]




GTP_A_3(1GWN)
RND3_MOUSE
[Raw transfer]




GNP_A_4(3SU8)
RAC1_HUMAN
[Raw transfer]




GTP_A_3(1E96)
RAC1_HUMAN
[Raw transfer]




GNP_A_3(1MH1)
RAC1_HUMAN
[Raw transfer]




GCP_A_4(2QME)
RAC3_HUMAN
[Raw transfer]




GTP_A_2(2WKQ)
RAC1_HUMAN
[Raw transfer]




GNP_B_8(1NF3)
CDC42_HUMAN
[Raw transfer]




GNP_C_7(3EG5)
CDC42_MOUSE
[Raw transfer]




GCP_A_8(2ODB)
CDC42_HUMAN
[Raw transfer]




GSP_A_5(2FJU)
RAC1_HUMAN
[Raw transfer]




GNP_A_7(1NF3)
CDC42_HUMAN
[Raw transfer]




GNP_A_5(2ATX)
RHOQ_HUMAN
[Raw transfer]




GCP_B_7(2QRZ)
CDC42_HUMAN
[Raw transfer]




GSP_A_3(3REG)
?
[Raw transfer]




GNP_C_5(3RYT)
RAC1_HUMAN
[Raw transfer]




GNP_D_10(1AM4)
CDC42_HUMAN
[Raw transfer]




GNP_A_7(2IC5)
RAC3_HUMAN
[Raw transfer]




GDP_A_4(1GRN)
CDC42_HUMAN
[Raw transfer]




GNP_B_5(3TH5)
RAC1_HUMAN
[Raw transfer]




GDP_A_4(2NGR)
CDC42_HUMAN
[Raw transfer]




GNP_F_12(1AM4)
CDC42_HUMAN
[Raw transfer]




GTP_A_3(1M7B)
RND3_HUMAN
[Raw transfer]




GNP_B_5(3Q3J)
RND1_HUMAN
[Raw transfer]




GNP_E_11(1AM4)
CDC42_HUMAN
[Raw transfer]




GDP_C_8(4ITR)
CDC42_HUMAN
[Raw transfer]




GTP_B_3(2WMO)
CDC42_HUMAN
[Raw transfer]




GNP_D_5(1I4T)
RAC1_HUMAN
[Raw transfer]




GCP_A_6(2QRZ)
CDC42_HUMAN
[Raw transfer]




GDP_D_12(4ITR)
CDC42_HUMAN
[Raw transfer]




GDP_A_5(1DOA)
CDC42_HUMAN
[Raw transfer]




GDP_B_13(2P2L)
RAC1_HUMAN
[Raw transfer]




GDP_R_4(1G4U)
RAC1_HUMAN
[Raw transfer]




GDP_B_8(2IC5)
RAC3_HUMAN
[Raw transfer]




GDP_C_6(3QBV)
CDC42_HUMAN
[Raw transfer]




GDP_A_3(4DID)
CDC42_HUMAN
[Raw transfer]




GDP_A_7(2H7V)
RAC1_HUMAN
[Raw transfer]




GDP_C_14(2P2L)
RAC1_HUMAN
[Raw transfer]




GDP_A_5(3QBV)
CDC42_HUMAN
[Raw transfer]




GDP_B_19(2C2H)
RAC3_HUMAN
[Raw transfer]




GDP_A_5(1HH4)
RAC1_HUMAN
[Raw transfer]




GDP_D_5(1I4D)
RAC1_HUMAN
[Raw transfer]




GDP_A_4(1A4R)
CDC42_HUMAN
[Raw transfer]




GDP_D_5(1I4L)
RAC1_HUMAN
[Raw transfer]




GDP_B_3(2WMN)
CDC42_HUMAN
[Raw transfer]




GDP_A_12(2P2L)
RAC1_HUMAN
[Raw transfer]




GDP_A_3(2C2H)
RAC3_HUMAN
[Raw transfer]




GDP_A_8(2G0N)
RAC3_HUMAN
[Raw transfer]




GDP_A_5(1U8Z)
RALA_SAGOE
[Raw transfer]




GDP_A_3(2Q3H)
RHOU_HUMAN
[Raw transfer]




GDP_A_5(2J0V)
RAC7_ARATH
[Raw transfer]




GOL_B_5(2WM9)
CDC42_HUMAN
[Raw transfer]




GNH_B_5(1A4R)
CDC42_HUMAN
[Raw transfer]




GDP_B_8(2H7V)
RAC1_HUMAN
[Raw transfer]




GDP_B_2(2FV8)
RHOB_HUMAN
[Raw transfer]




GDP_A_2(2J1L)
RHOD_HUMAN
[Raw transfer]




GDP_B_6(1AN0)
CDC42_HUMAN
[Raw transfer]




GDP_A_5(1AN0)
CDC42_HUMAN
[Raw transfer]




AF3_A_5(2NGR)
CDC42_HUMAN
[Raw transfer]




AF3_A_5(1GRN)
CDC42_HUMAN
[Raw transfer]




AF3_R_5(1G4U)
RAC1_HUMAN
[Raw transfer]




25 PsiBlast_CBE 96.72100%-131 - C1 -1GRN 7.8 CDC42_HUMAN
24 PsiBlast_CBE 95.25100%-129 - C1 -2NGR 8.2 CDC42_HUMAN
37 PsiBlast_CBE 94.19100%-143 - C1 -1DOA 6.3 CDC42_HUMAN
26 PsiBlast_CBE 93.2099%-139 - C1 -1A4R 8.1 CDC42_HUMAN
29 PsiBlast_CBE 93.08100%-133 - C1 -2QRZ 8.1 CDC42_HUMAN
34 PsiBlast_CBE 92.6998%-129 - C1 -1NF3 9.5 CDC42_HUMAN
33 PsiBlast_CBE 92.6998%-130 - C1 -1NF3 9.2 CDC42_HUMAN
27 PsiBlast_CBE 92.2399%-132 - C1 -1A4R 7.9 CDC42_HUMAN
28 PsiBlast_CBE 91.66100%-130 - C1 -2QRZ 7.2 CDC42_HUMAN
45 PsiBlast_CBE 90.4499%-141 - C1 -3EG5 9.2 CDC42_MOUSE
44 PsiBlast_CBE 90.0299%-142 - C1 -3EG5 9.5 CDC42_MOUSE
41 PsiBlast_CBE 89.91100%-134 - C1 -4DID 7.8 CDC42_HUMAN
22 PsiBlast_CBE 89.89100%-138 - C1 -4ITR 7.6 CDC42_HUMAN
46 PsiBlast_CBE 89.2399%-140 - C1 -3QBV 6.2 CDC42_HUMAN
23 PsiBlast_CBE 89.19100%-142 - C1 -4ITR 7.5 CDC42_HUMAN
1 PsiBlast_PDB 89.16100%-131 - C1 -2ODB 9.6 CDC42_HUMAN
47 PsiBlast_CBE 89.0799%-140 - C1 -3QBV 6.2 CDC42_HUMAN
32 PsiBlast_CBE 88.58100%-135 - C1 -2WM9 2.8 CDC42_HUMAN
30 PsiBlast_CBE 87.96100%-135 - C1 -2WMO 6.7 CDC42_HUMAN
31 PsiBlast_CBE 86.92100%-134 - C1 -2WMN 5.5 CDC42_HUMAN
6 PsiBlast_PDB 85.9069%-142 - C1 -1HH4 7.1 RAC1_HUMAN
49 PsiBlast_CBE 85.7799%-146 - C1 -1AM4 6.2 CDC42_HUMAN
53 PsiBlast_CBE 85.2971%-140 - C1 -2H7V 7.4 RAC1_HUMAN
66 PsiBlast_CBE 85.0072%-139 - C1 -2G0N 7.9 RAC3_HUMAN
50 PsiBlast_CBE 84.9799%-146 - C1 -1AM4 6.5 CDC42_HUMAN
48 PsiBlast_CBE 84.8299%-144 - C1 -1AM4 6.7 CDC42_HUMAN
67 PsiBlast_CBE 84.4472%-133 - C1 -2IC5 7.9 RAC3_HUMAN
68 PsiBlast_CBE 84.4172%-139 - C1 -2IC5 9.4 RAC3_HUMAN
56 PsiBlast_CBE 84.3172%-139 - C1 -2QME 10.0 RAC3_HUMAN
72 PsiBlast_CBE 84.0272%-141 - C1 -2C2H 7.5 RAC3_HUMAN
9 PsiBlast_PDB 83.9971%-141 - C1 -2H7V 7.7 RAC1_HUMAN
86 HHSearch 83.8971%-135 - C1 -1MH1 8.9 RAC1_HUMAN
51 PsiBlast_CBE 83.7471%-137 - C1 -2P2L 8.1 RAC1_HUMAN
65 PsiBlast_CBE 83.7172%-136 - C1 -2G0N - RAC3_HUMAN
18 PsiBlast_PDB 83.4771%-140 - C1 -3SU8 9.0 RAC1_HUMAN
13 PsiBlast_PDB 82.8572%-142 - C1 -3TH5 9.3 RAC1_HUMAN
11 PsiBlast_PDB 82.6571%-134 - C1 -1G4U 6.9 RAC1_HUMAN
52 PsiBlast_CBE 82.3571%-136 - C1 -2P2L 8.1 RAC1_HUMAN
91 HHSearch 81.9369%-136 - C1 -2WKQ 10.5 RAC1_HUMAN
73 PsiBlast_CBE 81.2872%-139 - C1 -2C2H 7.7 RAC3_HUMAN
7 PsiBlast_PDB 81.2569%-136 - C1 -1E96 10.2 RAC1_HUMAN
3 PsiBlast_PDB 81.2270%-137 - C1 -1I4D 6.9 RAC1_HUMAN
74 PsiBlast_CBE 80.8872%-144 - C1 -3TH5 7.9 RAC1_HUMAN
10 PsiBlast_PDB 80.7571%-132 - C1 -2P2L 8.2 RAC1_HUMAN
16 PsiBlast_PDB 80.6472%-135 - C1 -2FJU 9.6 RAC1_HUMAN
87 HHSearch 80.5670%-137 - C1 -2ATX 7.5 RHOQ_HUMAN
4 PsiBlast_PDB 79.5170%-134 - C1 -1I4L 6.4 RAC1_HUMAN
5 PsiBlast_PDB 78.8169%-135 - C1 -1I4T 7.8 RAC1_HUMAN
75 PsiBlast_CBE 78.1671%-130 - C1 -3RYT 9.3 RAC1_HUMAN
94 HHSearch 76.4453%-140 - C1 -2J0V 8.0 RAC7_ARATH
88 HHSearch 76.3053%-135 - C1 -2FV8 7.9 RHOB_HUMAN
89 HHSearch 76.1860%-130 - C1 -2Q3H 6.9 RHOU_HUMAN
96 HHSearch 71.5841%-127 - C1 -1GWN 9.2 RND3_MOUSE
85 HHSearch 70.9041%-129 - C1 -1M7B 9.4 RND3_HUMAN
97 HHSearch 68.0446%-143 - C1 -2J1L 7.1 RHOD_HUMAN
95 HHSearch 67.0038%-127 - C1 -3Q3J 10.1 RND1_HUMAN
93 HHSearch 66.9243%-134 - C1 -3REG 9.4 ?
39 PsiBlast_CBE 64.6199% -66 - C1 -1AN0 5.9 CDC42_HUMAN
40 PsiBlast_CBE 62.1499% -69 - C1 -1AN0 7.0 CDC42_HUMAN
110 HHSearch 58.6233%-134 - C1 -1U8Z 7.4 RALA_SAGOE