@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00089_TRY1_B: (2014-08-23 )
FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN

Atome Classification :

(55 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BEN_A_3(4I8L)
TRY1_BOVIN
[Raw transfer]




BEN_A_6(3RXV)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(3T28)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(4I8J)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(4I8H)
TRY1_BOVIN
[Raw transfer]




BEN_A_8(3RXQ)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(4I8K)
TRY1_BOVIN
[Raw transfer]




BEN_A_7(3RXU)
TRY1_BOVIN
[Raw transfer]




913_A_10(4ABE)
TRY1_BOVIN
[Raw transfer]




BEN_A_4(3T27)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(3T26)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY8)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BYA)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY5)
TRY1_BOVIN
[Raw transfer]




BEN_A_4(3T25)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY9)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY7)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY6)
TRY1_BOVIN
[Raw transfer]




7Z3_A_9(4ABH)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(4I8G)
TRY1_BOVIN
[Raw transfer]




GOL_C_24(4AOR)
TRY1_BOVIN
[Raw transfer]




0IV_A_2(1ZZZ)
TRY1_BOVIN
[Raw transfer]




SZ4_A_7(3RXS)
TRY1_BOVIN
[Raw transfer]




SW2_A_7(3RXO)
TRY1_BOVIN
[Raw transfer]




SW2_A_8(4ABD)
TRY1_BOVIN
[Raw transfer]




RPR_A_4(1F0U)
TRY1_BOVIN
[Raw transfer]




GOL_B_16(4AOR)
TRY1_BOVIN
[Raw transfer]




SAR_A_4(3T26)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(3T29)
TRY1_BOVIN
[Raw transfer]




VXQ_A_7(4AB9)
TRY1_BOVIN
[Raw transfer]




PR1_A_5(1F0T)
TRY1_BOVIN
[Raw transfer]




GBS_A_10(3RXJ)
TRY1_BOVIN
[Raw transfer]




SW3_A_8(3RXP)
TRY1_BOVIN
[Raw transfer]




GOL_A_3(3RXK)
TRY1_BOVIN
[Raw transfer]




IMA_A_4(1LQE)
TRY1_BOVIN
[Raw transfer]




SZ4_A_7(3RXT)
TRY1_BOVIN
[Raw transfer]




SZ9_A_7(3RXL)
TRY1_BOVIN
[Raw transfer]




GHS_A_2(3VPK)
TRY1_BOVIN
[Raw transfer]




GOL_A_3(3RXJ)
TRY1_BOVIN
[Raw transfer]




SZ8_A_8(3RXK)
TRY1_BOVIN
[Raw transfer]




SW1_A_12(4ABA)
TRY1_BOVIN
[Raw transfer]




SW1_A_9(3RXM)
TRY1_BOVIN
[Raw transfer]




GOL_A_3(3RXO)
TRY1_BOVIN
[Raw transfer]




GOL_A_3(3RXP)
TRY1_BOVIN
[Raw transfer]




BEN_A_8(2AIQ)
VSPCA_AGKCO
[Raw transfer]




PBZ_A_11(2BDG)
KLK4_HUMAN
[Raw transfer]




BEN_A_3(1LO6)
KLK6_HUMAN
[Raw transfer]




SZ1_A_8(3RXR)
TRY1_BOVIN
[Raw transfer]




GOL_A_3(3RXL)
TRY1_BOVIN
[Raw transfer]




513_A_8(4ABF)
TRY1_BOVIN
[Raw transfer]




K9S_A_8(4ABB)
TRY1_BOVIN
[Raw transfer]




CHAIN_B_2(3S9C)
VSPG_DABSI
[Raw transfer]

-

CHAIN_B_2(4ABJ)
TRY1_BOVIN
[Raw transfer]

-

K7J_A_2(2QXI)
KLK7_HUMAN
[Raw transfer]




BET_A_5(3T27)
TRY1_BOVIN
[Raw transfer]




CHAIN_B_2(4ABI)
TRY1_BOVIN
[Raw transfer]

-

E4B_A_4(3VPK)
TRY1_BOVIN
[Raw transfer]




DFP_A_3(2TGD)
TRY1_BOVIN
[Raw transfer]




CHAIN_I_2(4HGC)
TRY1_BOVIN
[Raw transfer]

-

TMO_A_10(3T29)
TRY1_BOVIN
[Raw transfer]




1PE_B_9(4AOQ)
TRY1_BOVIN
[Raw transfer]




CHAIN_I_3(1FXY)
TRY1_HUMAN
[Raw transfer]

-

CHAIN_B_2(2PSX)
KLK5_HUMAN
[Raw transfer]

-

ACE_B_4(2PSX)
KLK5_HUMAN
[Raw transfer]




CH2_I_5(1FXY)
TRY1_HUMAN
[Raw transfer]




52 PsiBlast_CBE 98.16100%-120 - C1 -4AB9 3.1 TRY1_BOVIN
57 PsiBlast_CBE 98.09100%-120 - C1 -3T26 3.8 TRY1_BOVIN
5 PsiBlast_PDB 97.99100%-117 - C1 -2BY6 3.4 TRY1_BOVIN
62 PsiBlast_CBE 97.95100%-119 - C1 -3RXS 3.2 TRY1_BOVIN
42 PsiBlast_CBE 97.95100%-120 - C1 -4AOQ 2.0 TRY1_BOVIN
56 PsiBlast_CBE 97.93100%-118 - C1 -3T27 3.3 TRY1_BOVIN
68 PsiBlast_CBE 97.92100%-119 - C1 -3RXL 3.0 TRY1_BOVIN
7 PsiBlast_PDB 97.88100%-118 - C1 -2BY8 3.5 TRY1_BOVIN
66 PsiBlast_CBE 97.79100%-118 - C1 -3RXO 4.2 TRY1_BOVIN
51 PsiBlast_CBE 97.71100%-119 - C1 -4ABA 3.2 TRY1_BOVIN
46 PsiBlast_CBE 97.70100%-117 - C1 -4ABH 3.9 TRY1_BOVIN
6 PsiBlast_PDB 97.69100%-117 - C1 -2BY7 3.4 TRY1_BOVIN
3 PsiBlast_PDB 97.67100%-118 - C1 -1LQE 7.0 TRY1_BOVIN
58 PsiBlast_CBE 97.66100%-116 - C1 -3T25 3.4 TRY1_BOVIN
70 PsiBlast_CBE 97.64100%-119 - C1 -3RXJ 3.9 TRY1_BOVIN
2 PsiBlast_PDB 97.64100%-118 - C1 -1F0U 8.0 TRY1_BOVIN
59 PsiBlast_CBE 97.59100%-120 - C1 -3RXV 3.4 TRY1_BOVIN
39 PsiBlast_CBE 97.58100%-117 - C1 -4AOR 2.1 TRY1_BOVIN
50 PsiBlast_CBE 97.57100%-118 - C1 -4ABB 3.5 TRY1_BOVIN
4 PsiBlast_PDB 97.56100%-117 - C1 -2BY5 3.5 TRY1_BOVIN
65 PsiBlast_CBE 97.50100%-117 - C1 -3RXP 2.9 TRY1_BOVIN
34 PsiBlast_CBE 97.50100%-117 - C1 -4I8J 3.3 TRY1_BOVIN
9 PsiBlast_PDB 97.50100%-117 - C1 -2BYA 3.5 TRY1_BOVIN
54 PsiBlast_CBE 97.48100%-118 - C1 -3T29 3.3 TRY1_BOVIN
64 PsiBlast_CBE 97.40100%-118 - C1 -3RXQ 3.2 TRY1_BOVIN
48 PsiBlast_CBE 97.40100%-117 - C1 -4ABE 3.8 TRY1_BOVIN
61 PsiBlast_CBE 97.38100%-117 - C1 -3RXT 3.2 TRY1_BOVIN
38 PsiBlast_CBE 97.38100%-116 - C1 -4AOR 2.3 TRY1_BOVIN
53 PsiBlast_CBE 97.35100%-119 - C1 -3VPK 2.9 TRY1_BOVIN
47 PsiBlast_CBE 97.31100%-117 - C1 -4ABF 3.9 TRY1_BOVIN
81 HHSearch 97.29100%-118 - C1 -4I8H 3.3 TRY1_BOVIN
11 PsiBlast_PDB 97.29100%-116 - C1 -1ZZZ 4.0 TRY1_BOVIN
45 PsiBlast_CBE 97.28100%-115 - C1 -4ABI 9.8 TRY1_BOVIN
69 PsiBlast_CBE 97.21100%-117 - C1 -3RXK 3.0 TRY1_BOVIN
63 PsiBlast_CBE 97.19100%-118 - C1 -3RXR 3.1 TRY1_BOVIN
44 PsiBlast_CBE 97.18100%-115 - C1 -4ABJ 10.1 TRY1_BOVIN
37 PsiBlast_CBE 97.17100%-115 - C1 -4HGC 9.5 TRY1_BOVIN
67 PsiBlast_CBE 97.15100%-116 - C1 -3RXM 3.2 TRY1_BOVIN
60 PsiBlast_CBE 97.15100%-119 - C1 -3RXU 3.3 TRY1_BOVIN
8 PsiBlast_PDB 97.15100%-117 - C1 -2BY9 3.4 TRY1_BOVIN
36 PsiBlast_CBE 97.11100%-116 - C1 -4I8G 3.2 TRY1_BOVIN
33 PsiBlast_CBE 97.11100%-118 - C1 -4I8K 3.2 TRY1_BOVIN
1 PsiBlast_PDB 97.10100%-117 - C1 -1F0T 5.5 TRY1_BOVIN
49 PsiBlast_CBE 97.05100%-116 - C1 -4ABD 4.1 TRY1_BOVIN
32 PsiBlast_CBE 96.96100%-117 - C1 -4I8L 3.3 TRY1_BOVIN
55 PsiBlast_CBE 96.91100%-116 - C1 -3T28 3.2 TRY1_BOVIN
40 PsiBlast_CBE 96.30100%-112 - C1 -4AOR - TRY1_BOVIN
25 PsiBlast_CBE 92.53100%-108 - C1 -2TGD 2.6 TRY1_BOVIN
83 HHSearch 80.0056%-108 - C1 -1FXY 4.5 TRY1_HUMAN
89 HHSearch 74.3548% -99 * C1 *2PSX 3.5 KLK5_HUMAN
84 HHSearch 73.9845%-100 - C1 -1LO6 2.8 KLK6_HUMAN
96 HHSearch 73.7844%-101 - C1 -2QXI 4.4 KLK7_HUMAN
103 HHSearch 71.7039%-101 - C1 -2AIQ 3.0 VSPCA_AGKCO
92 HHSearch 71.6941% -98 - C1 -2BDG 3.0 KLK4_HUMAN
97 HHSearch 71.2841% -98 - C1 -3S9C 1.1 VSPG_DABSI