@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00089_TRY2_R: (2014-08-24 )
MRALLFLALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BEN_A_5(1DPO)
TRY2_RAT
[Raw transfer]




BEN_A_4(1J14)
TRY2_RAT
[Raw transfer]




BEN_A_3(1ANC)
TRY2_RAT
[Raw transfer]




BEN_A_3(1AND)
TRY2_RAT
[Raw transfer]




BEN_A_4(1J15)
TRY2_RAT
[Raw transfer]




0IV_A_2(1ZZZ)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BYA)
TRY1_BOVIN
[Raw transfer]




RPR_A_4(1F0U)
TRY1_BOVIN
[Raw transfer]




BEN_A_2(1H4W)
TRY3_HUMAN
[Raw transfer]




BEN_A_5(1TRM)
TRY2_RAT
[Raw transfer]




BAM_X_2(2BY7)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY9)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(1BRA)
TRY2_RAT
[Raw transfer]




BEN_B_6(1TRM)
TRY2_RAT
[Raw transfer]




PR1_A_5(1F0T)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY8)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(1ANB)
TRY2_RAT
[Raw transfer]




BEN_A_3(4I8H)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY6)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY5)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(2TRM)
TRY2_RAT
[Raw transfer]




IMA_A_4(1LQE)
TRY1_BOVIN
[Raw transfer]




BEN_A_8(2AIQ)
VSPCA_AGKCO
[Raw transfer]




BEN_A_3(1LO6)
KLK6_HUMAN
[Raw transfer]




PBZ_A_11(2BDG)
KLK4_HUMAN
[Raw transfer]




ZEN_A_4(1QL9)
TRY2_RAT
[Raw transfer]




FMT_B_19(3L33)
TRY3_HUMAN
[Raw transfer]




ZEN_T_4(1J17)
TRY2_RAT
[Raw transfer]




FMT_A_16(3L33)
TRY3_HUMAN
[Raw transfer]




CHAIN_B_2(1YF4)
TRYP_PIG
[Raw transfer]

-

K7J_A_2(2QXI)
KLK7_HUMAN
[Raw transfer]




EDO_E_7(3FP8)
TRY2_RAT
[Raw transfer]




CHAIN_I_2(3FP7)
TRY2_RAT
[Raw transfer]

-

MOH_A_6(1FN6)
?
[Raw transfer]




CHAIN_I_3(1FXY)
TRY1_HUMAN
[Raw transfer]

-

EDO_E_9(3FP6)
TRY2_RAT
[Raw transfer]




DFP_A_3(2TGD)
TRY1_BOVIN
[Raw transfer]




CHAIN_B_2(2PSX)
KLK5_HUMAN
[Raw transfer]

-

ACE_B_4(2PSX)
KLK5_HUMAN
[Raw transfer]




CH2_I_5(1FXY)
TRY1_HUMAN
[Raw transfer]




30 PsiBlast_CBE 96.9999%-122 - C1 -1J14 3.0 TRY2_RAT
15 PsiBlast_PDB 96.1199%-120 - C1 -3FP8 2.3 TRY2_RAT
9 PsiBlast_PDB 96.06100%-120 - C1 -3FP6 3.1 TRY2_RAT
35 PsiBlast_CBE 96.0599%-120 - C1 -1BRA 2.6 TRY2_RAT
14 PsiBlast_PDB 95.9199%-121 - C1 -3FP7 3.6 TRY2_RAT
23 PsiBlast_CBE 95.7899%-122 - C1 -1AND 3.2 TRY2_RAT
29 PsiBlast_CBE 95.7199%-120 - C1 -1QL9 7.1 TRY2_RAT
18 PsiBlast_PDB 95.6399%-121 - C1 -1TRM 3.1 TRY2_RAT
19 PsiBlast_PDB 95.4099%-124 - C1 -2TRM 3.1 TRY2_RAT
16 PsiBlast_PDB 95.3599%-120 - C1 -1ANB 3.6 TRY2_RAT
24 PsiBlast_CBE 95.3499%-120 - C1 -1DPO 3.3 TRY2_RAT
37 PsiBlast_CBE 95.2996%-125 - C1 -1J16 - TRY2_RAT
17 PsiBlast_PDB 95.0599%-120 - C1 -1ANC 3.5 TRY2_RAT
21 PsiBlast_CBE 95.0099%-121 - C1 -1TRM 3.2 TRY2_RAT
36 PsiBlast_CBE 94.9696%-122 - C1 -1J17 6.7 TRY2_RAT
38 PsiBlast_CBE 94.5396%-122 - C1 -1J15 3.2 TRY2_RAT
56 PsiBlast_CBE 91.9781%-116 - C1 -1YF4 8.3 TRYP_PIG
73 PsiBlast_CBE 91.0180%-118 - C1 -1FN6 2.8 ?
50 PsiBlast_CBE 89.6674%-119 - C1 -1F0U 8.3 TRY1_BOVIN
93 PsiBlast_CBE 89.3877%-117 - C1 -1H4W 3.2 TRY3_HUMAN
52 PsiBlast_CBE 89.2175%-118 - C1 -1ZZZ 4.0 TRY1_BOVIN
51 PsiBlast_CBE 89.1574%-118 - C1 -1F0T 5.4 TRY1_BOVIN
88 PsiBlast_CBE 88.8577%-118 - C1 -3L33 2.8 TRY3_HUMAN
49 PsiBlast_CBE 88.8174%-120 - C1 -1LQE 7.1 TRY1_BOVIN
84 PsiBlast_CBE 88.6777%-119 - C1 -3L3T - TRY3_HUMAN
87 PsiBlast_CBE 88.3377%-117 - C1 -3L33 2.8 TRY3_HUMAN
45 PsiBlast_CBE 88.1674%-118 - C1 -2BY8 3.5 TRY1_BOVIN
46 PsiBlast_CBE 88.0374%-116 - C1 -2BY7 3.4 TRY1_BOVIN
47 PsiBlast_CBE 88.0174%-116 - C1 -2BY6 3.4 TRY1_BOVIN
43 PsiBlast_CBE 87.8974%-116 - C1 -2BYA 3.5 TRY1_BOVIN
48 PsiBlast_CBE 87.8674%-116 - C1 -2BY5 3.5 TRY1_BOVIN
83 PsiBlast_CBE 87.8377%-114 - C1 -3L3T - TRY3_HUMAN
112 HHSearch 87.7674%-118 - C1 -4I8H 3.3 TRY1_BOVIN
44 PsiBlast_CBE 87.5474%-117 - C1 -2BY9 3.4 TRY1_BOVIN
99 PsiBlast_CBE 82.7274%-111 - C1 -2TGD 2.6 TRY1_BOVIN
114 HHSearch 79.4257%-110 - C1 -1FXY 4.5 TRY1_HUMAN
119 HHSearch 74.6847%-104 * C1 *2PSX 3.6 KLK5_HUMAN
127 HHSearch 73.9143%-105 - C1 -2QXI 4.4 KLK7_HUMAN
115 HHSearch 72.4646%-109 - C1 -1LO6 2.9 KLK6_HUMAN
123 HHSearch 72.2540%-104 - C1 -2BDG 3.0 KLK4_HUMAN
134 HHSearch 69.7141%-103 - C1 -2AIQ 3.0 VSPCA_AGKCO