@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00106_DHI1_M: (2014-08-27 )
MAVMKNYLLPILVLFLAYYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMFVSN

Atome Classification :

(55 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3PJ_A_3(3PDJ)
DHI1_HUMAN
[Raw transfer]




A49_B_4(3FRJ)
DHI1_HUMAN
[Raw transfer]




IIG_B_6(3FCO)
DHI1_HUMAN
[Raw transfer]




D3E_B_8(3D3E)
DHI1_HUMAN
[Raw transfer]




IIG_A_4(3FCO)
DHI1_HUMAN
[Raw transfer]




D3E_A_6(3D3E)
DHI1_HUMAN
[Raw transfer]




D3E_C_10(3D3E)
DHI1_HUMAN
[Raw transfer]




D4N_B_8(3D4N)
DHI1_HUMAN
[Raw transfer]




HD2_C_10(4BB5)
DHI1_HUMAN
[Raw transfer]




D3E_D_12(3D3E)
DHI1_HUMAN
[Raw transfer]




HD1_B_7(4BB6)
DHI1_HUMAN
[Raw transfer]




HD2_A_6(4BB5)
DHI1_HUMAN
[Raw transfer]




HD1_A_4(4BB6)
DHI1_HUMAN
[Raw transfer]




17R_C_9(3HFG)
DHI1_HUMAN
[Raw transfer]




C0R_A_5(1Y5R)
DHI1_MOUSE
[Raw transfer]




19V_A_5(4HX5)
DHI1_HUMAN
[Raw transfer]




3OQ_C_6(3OQ1)
DHI1_HUMAN
[Raw transfer]




NDP_C_3(1XSE)
DHI1_CAVPO
[Raw transfer]




NDP_A_3(1Y5R)
DHI1_MOUSE
[Raw transfer]




NAP_B_7(3H6K)
DHI1_HUMAN
[Raw transfer]




S05_C_9(3QQP)
DHI1_HUMAN
[Raw transfer]




NDP_C_10(4HX5)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(4BB5)
DHI1_HUMAN
[Raw transfer]




C0R_B_6(1Y5R)
DHI1_MOUSE
[Raw transfer]




NAP_A_3(3FCO)
DHI1_HUMAN
[Raw transfer]




NAP_B_5(3FRJ)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D5Q)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(3FRJ)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3OQ1)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(3CZR)
DHI1_HUMAN
[Raw transfer]




NDP_C_10(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3H6K)
DHI1_HUMAN
[Raw transfer]




17R_A_5(3HFG)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3D5Q)
DHI1_HUMAN
[Raw transfer]




NAP_C_10(3HFG)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3OQ1)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3BZU)
DHI1_HUMAN
[Raw transfer]




NDP_B_4(1Y5R)
DHI1_MOUSE
[Raw transfer]




NDP_D_12(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_B_5(3FCO)
DHI1_HUMAN
[Raw transfer]




NDP_A_7(1Y5M)
DHI1_MOUSE
[Raw transfer]




NAP_C_9(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_B_6(3PDJ)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_A_6(3HFG)
DHI1_HUMAN
[Raw transfer]




NAP_A_4(3PDJ)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D4N)
DHI1_HUMAN
[Raw transfer]




NDP_B_8(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(4BB6)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3OQ1)
DHI1_HUMAN
[Raw transfer]




NAP_B_6(4BB6)
DHI1_HUMAN
[Raw transfer]




HD2_D_12(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3D4N)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3D5Q)
DHI1_HUMAN
[Raw transfer]




NDP_A_6(3QQP)
DHI1_HUMAN
[Raw transfer]




NDP_B_8(1Y5M)
DHI1_MOUSE
[Raw transfer]




NDP_D_12(4HX5)
DHI1_HUMAN
[Raw transfer]




NDP_B_8(4HX5)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3OQ1)
DHI1_HUMAN
[Raw transfer]




NDP_A_6(4HX5)
DHI1_HUMAN
[Raw transfer]




NAP_D_12(3HFG)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3H6K)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(4BB5)
DHI1_HUMAN
[Raw transfer]




S05_A_5(3QQP)
DHI1_HUMAN
[Raw transfer]




D4N_C_10(3D4N)
DHI1_HUMAN
[Raw transfer]




3OQ_B_8(3OQ1)
DHI1_HUMAN
[Raw transfer]




NAP_B_4(3CZR)
DHI1_HUMAN
[Raw transfer]




NDP_A_5(1XU7)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3H6K)
DHI1_HUMAN
[Raw transfer]




NDP_A_5(1XU9)
DHI1_HUMAN
[Raw transfer]




D4N_A_6(3D4N)
DHI1_HUMAN
[Raw transfer]




S05_D_11(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3D3E)
DHI1_HUMAN
[Raw transfer]




19V_C_9(4HX5)
DHI1_HUMAN
[Raw transfer]




S05_B_7(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3D4N)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3D5Q)
DHI1_HUMAN
[Raw transfer]




3OQ_A_12(3OQ1)
DHI1_HUMAN
[Raw transfer]




3CZ_A_6(3CZR)
DHI1_HUMAN
[Raw transfer]




33T_B_8(3H6K)
DHI1_HUMAN
[Raw transfer]




33T_C_10(3H6K)
DHI1_HUMAN
[Raw transfer]




33T_A_6(3H6K)
DHI1_HUMAN
[Raw transfer]




CPS_B_5(3CZR)
DHI1_HUMAN
[Raw transfer]




T30_C_10(3D5Q)
DHI1_HUMAN
[Raw transfer]




CPS_A_9(1XU9)
DHI1_HUMAN
[Raw transfer]




A21_A_6(3BZU)
DHI1_HUMAN
[Raw transfer]




A21_B_8(3BZU)
DHI1_HUMAN
[Raw transfer]




A21_D_12(3BZU)
DHI1_HUMAN
[Raw transfer]




A21_C_10(3BZU)
DHI1_HUMAN
[Raw transfer]




OCT_A_9(1Y5M)
DHI1_MOUSE
[Raw transfer]




MES_A_13(1XU9)
DHI1_HUMAN
[Raw transfer]




2 PsiBlast_PDB 96.40100%-129 - C4 -1Y5R 11.1 DHI1_MOUSE
1 PsiBlast_PDB 95.54100%-125 - C4 -1Y5M 9.4 DHI1_MOUSE
22 PsiBlast_CBE 93.67100%-128 - C4 -1Y5M 10.0 DHI1_MOUSE
21 PsiBlast_CBE 93.59100%-120 - C4 -1Y5R 10.9 DHI1_MOUSE
63 Fugue 88.0274%-124 - C4 -1XSE 12.3 DHI1_CAVPO
39 PsiBlast_CBE 85.5478%-120 - C4 -4HX5 12.9 DHI1_HUMAN
20 PsiBlast_PDB 85.3678%-120 - C4 -4HX5 13.2 DHI1_HUMAN
46 PsiBlast_CBE 85.3478%-117 - C4 -3OQ1 12.0 DHI1_HUMAN
9 PsiBlast_PDB 84.8778%-115 - C4 -1XU9 12.8 DHI1_HUMAN
45 PsiBlast_CBE 84.3278%-114 - C4 -3OQ1 12.6 DHI1_HUMAN
43 PsiBlast_CBE 83.9578%-120 - C4 -3QQP 12.3 DHI1_HUMAN
54 PsiBlast_CBE 83.9078%-118 - C4 -3D4N 13.0 DHI1_HUMAN
44 PsiBlast_CBE 83.7578%-122 - C4 -3OQ1 12.5 DHI1_HUMAN
41 PsiBlast_CBE 83.6978%-121 - C4 -3QQP 12.7 DHI1_HUMAN
6 PsiBlast_PDB 83.6478%-119 - C4 -3PDJ 13.4 DHI1_HUMAN
11 PsiBlast_PDB 83.4878%-117 - C4 -3CZR 12.4 DHI1_HUMAN
42 PsiBlast_CBE 83.4678%-117 - C4 -3QQP 13.0 DHI1_HUMAN
14 PsiBlast_PDB 83.3978%-119 - C4 -3FRJ 13.1 DHI1_HUMAN
40 PsiBlast_CBE 83.0678%-120 - C4 -4HX5 13.2 DHI1_HUMAN
49 PsiBlast_CBE 82.9878%-121 - C4 -3H6K 12.4 DHI1_HUMAN
19 PsiBlast_PDB 82.9678%-116 - C4 -3QQP 12.8 DHI1_HUMAN
7 PsiBlast_PDB 82.8578%-116 - C4 -3D5Q 12.3 DHI1_HUMAN
51 PsiBlast_CBE 82.7978%-119 - C4 -3H6K 12.4 DHI1_HUMAN
10 PsiBlast_PDB 82.7978%-114 - C4 -3BZU 12.7 DHI1_HUMAN
16 PsiBlast_PDB 82.7578%-115 - C4 -3FCO 12.3 DHI1_HUMAN
17 PsiBlast_PDB 82.6278%-117 - C4 -3H6K 12.3 DHI1_HUMAN
55 PsiBlast_CBE 82.5778%-119 - C4 -3D4N 12.8 DHI1_HUMAN
35 PsiBlast_CBE 82.5578%-121 - C4 -3D5Q 12.0 DHI1_HUMAN
37 PsiBlast_CBE 82.5178%-119 - C4 -3D5Q 12.7 DHI1_HUMAN
13 PsiBlast_PDB 82.2678%-115 - C4 -3D4N 13.1 DHI1_HUMAN
34 PsiBlast_CBE 82.2378%-121 - C4 -3PDJ 12.7 DHI1_HUMAN
57 PsiBlast_CBE 82.0278%-119 - C4 -3D3E 13.3 DHI1_HUMAN
53 PsiBlast_CBE 81.9378%-119 - C4 -3FCO 12.0 DHI1_HUMAN
38 PsiBlast_CBE 81.9278%-120 - C4 -4HX5 13.3 DHI1_HUMAN
33 PsiBlast_CBE 81.9078%-117 - C4 -4BB5 13.0 DHI1_HUMAN
31 PsiBlast_CBE 81.6778%-115 - C4 -4BB5 12.7 DHI1_HUMAN
8 PsiBlast_PDB 81.4978%-114 - C4 -1XU7 13.2 DHI1_HUMAN
32 PsiBlast_CBE 81.4178%-119 - C4 -4BB5 12.6 DHI1_HUMAN
30 PsiBlast_CBE 81.3278%-119 - C4 -4BB6 13.3 DHI1_HUMAN
52 PsiBlast_CBE 81.2278%-118 - C4 -3FRJ 12.9 DHI1_HUMAN
12 PsiBlast_PDB 81.1078%-117 - C4 -3D3E 12.4 DHI1_HUMAN
5 PsiBlast_PDB 81.0778%-118 - C4 -4BB5 13.0 DHI1_HUMAN
60 PsiBlast_CBE 80.9778%-123 - C4 -3BZU 12.7 DHI1_HUMAN
61 PsiBlast_CBE 80.9378%-117 - C4 -3BZU 13.0 DHI1_HUMAN
62 PsiBlast_CBE 80.5878%-116 - C4 -3BZU 12.9 DHI1_HUMAN
4 PsiBlast_PDB 80.5178%-113 - C4 -4BB6 13.2 DHI1_HUMAN
56 PsiBlast_CBE 80.1978%-119 - C4 -3D3E 12.4 DHI1_HUMAN
18 PsiBlast_PDB 80.1678%-116 - C4 -3OQ1 11.7 DHI1_HUMAN
58 PsiBlast_CBE 79.9478%-118 - C4 -3D3E 13.1 DHI1_HUMAN
15 PsiBlast_PDB 79.9178%-116 - C4 -3HFG 12.7 DHI1_HUMAN
50 PsiBlast_CBE 79.8778%-117 - C4 -3H6K 12.3 DHI1_HUMAN
48 PsiBlast_CBE 79.4678%-117 - C4 -3HFG 13.1 DHI1_HUMAN
47 PsiBlast_CBE 79.2978%-118 - C4 -3HFG 11.3 DHI1_HUMAN
36 PsiBlast_CBE 78.3478%-115 - C4 -3D5Q 13.0 DHI1_HUMAN
59 PsiBlast_CBE 77.9178%-116 - C4 -3CZR 12.9 DHI1_HUMAN