@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00106_DHI1_R: (2014-08-27 )
MKKYLLPVLVLCLGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMAFAERFVVEAGKLLGGLDMLILNHITQTTMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGSIAIISSMAGKMTQPLIASYSASKFALDGFFSTIRKEHLMTKVNVSITLCVLGFIDTETALKETSGIILSQAAPKEECALEIIKGTVLRKDEVYYDKSSWTPLLLGNPGRRIMEFLSLRSYNRDLFVSN

Atome Classification :

(55 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CPS_C_11(1XU9)
DHI1_HUMAN
[Raw transfer]




A49_B_4(3FRJ)
DHI1_HUMAN
[Raw transfer]




19V_A_5(4HX5)
DHI1_HUMAN
[Raw transfer]




3PJ_A_3(3PDJ)
DHI1_HUMAN
[Raw transfer]




HD2_A_6(4BB5)
DHI1_HUMAN
[Raw transfer]




3OQ_D_10(3OQ1)
DHI1_HUMAN
[Raw transfer]




HD2_C_10(4BB5)
DHI1_HUMAN
[Raw transfer]




C0R_A_5(1Y5R)
DHI1_MOUSE
[Raw transfer]




D3E_B_8(3D3E)
DHI1_HUMAN
[Raw transfer]




IIG_A_4(3FCO)
DHI1_HUMAN
[Raw transfer]




19V_C_9(4HX5)
DHI1_HUMAN
[Raw transfer]




19V_B_7(4HX5)
DHI1_HUMAN
[Raw transfer]




C0R_B_6(1Y5R)
DHI1_MOUSE
[Raw transfer]




CPS_D_12(1XU7)
DHI1_HUMAN
[Raw transfer]




HD2_D_12(4BB5)
DHI1_HUMAN
[Raw transfer]




D3E_A_6(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3D4N)
DHI1_HUMAN
[Raw transfer]




HD1_B_7(4BB6)
DHI1_HUMAN
[Raw transfer]




S05_C_9(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_C_10(3HFG)
DHI1_HUMAN
[Raw transfer]




HD1_A_4(4BB6)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(3CZR)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D5Q)
DHI1_HUMAN
[Raw transfer]




S05_D_11(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(3FRJ)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(3FCO)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_D_12(3HFG)
DHI1_HUMAN
[Raw transfer]




NDP_C_3(1XSE)
DHI1_CAVPO
[Raw transfer]




NDP_A_6(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_B_5(3FRJ)
DHI1_HUMAN
[Raw transfer]




NDP_C_10(4HX5)
DHI1_HUMAN
[Raw transfer]




NDP_B_8(1Y5M)
DHI1_MOUSE
[Raw transfer]




NAP_A_4(3PDJ)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3OQ1)
DHI1_HUMAN
[Raw transfer]




S05_A_5(3QQP)
DHI1_HUMAN
[Raw transfer]




NDP_C_10(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3D4N)
DHI1_HUMAN
[Raw transfer]




S05_B_7(3QQP)
DHI1_HUMAN
[Raw transfer]




NDP_A_6(4HX5)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3BZU)
DHI1_HUMAN
[Raw transfer]




NDP_D_12(4HX5)
DHI1_HUMAN
[Raw transfer]




NDP_B_8(3QQP)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3H6K)
DHI1_HUMAN
[Raw transfer]




NDP_D_12(3QQP)
DHI1_HUMAN
[Raw transfer]




NDP_B_4(1Y5R)
DHI1_MOUSE
[Raw transfer]




D3E_C_10(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_B_6(4BB6)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3H6K)
DHI1_HUMAN
[Raw transfer]




NDP_C_7(1XU9)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3OQ1)
DHI1_HUMAN
[Raw transfer]




NAP_C_9(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3OQ1)
DHI1_HUMAN
[Raw transfer]




NDP_B_8(4HX5)
DHI1_HUMAN
[Raw transfer]




NAP_A_6(3HFG)
DHI1_HUMAN
[Raw transfer]




NAP_B_5(3FCO)
DHI1_HUMAN
[Raw transfer]




NAP_A_3(4BB6)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3H6K)
DHI1_HUMAN
[Raw transfer]




NDP_A_3(1Y5R)
DHI1_MOUSE
[Raw transfer]




17R_A_5(3HFG)
DHI1_HUMAN
[Raw transfer]




D3E_D_12(3D3E)
DHI1_HUMAN
[Raw transfer]




NDP_A_7(1Y5M)
DHI1_MOUSE
[Raw transfer]




NAP_C_9(3OQ1)
DHI1_HUMAN
[Raw transfer]




NDP_D_8(1XU9)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_A_5(4BB5)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_B_7(3D4N)
DHI1_HUMAN
[Raw transfer]




NAP_B_4(3CZR)
DHI1_HUMAN
[Raw transfer]




NDP_A_5(1XU7)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3BZU)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3D3E)
DHI1_HUMAN
[Raw transfer]




NAP_D_11(3H6K)
DHI1_HUMAN
[Raw transfer]




NDP_A_5(1XU9)
DHI1_HUMAN
[Raw transfer]




NDP_D_11(1XU7)
DHI1_HUMAN
[Raw transfer]




NDP_B_6(1XU9)
DHI1_HUMAN
[Raw transfer]




3OQ_B_8(3OQ1)
DHI1_HUMAN
[Raw transfer]




CPS_A_9(1XU9)
DHI1_HUMAN
[Raw transfer]




D4N_B_8(3D4N)
DHI1_HUMAN
[Raw transfer]




17R_C_9(3HFG)
DHI1_HUMAN
[Raw transfer]




T30_A_6(3D5Q)
DHI1_HUMAN
[Raw transfer]




D4N_C_10(3D4N)
DHI1_HUMAN
[Raw transfer]




CPS_B_5(3CZR)
DHI1_HUMAN
[Raw transfer]




3CZ_A_6(3CZR)
DHI1_HUMAN
[Raw transfer]




D4N_A_6(3D4N)
DHI1_HUMAN
[Raw transfer]




A21_A_6(3BZU)
DHI1_HUMAN
[Raw transfer]




33T_C_10(3H6K)
DHI1_HUMAN
[Raw transfer]




A21_B_8(3BZU)
DHI1_HUMAN
[Raw transfer]




3OQ_A_12(3OQ1)
DHI1_HUMAN
[Raw transfer]




A21_C_10(3BZU)
DHI1_HUMAN
[Raw transfer]




33T_A_6(3H6K)
DHI1_HUMAN
[Raw transfer]




A21_D_12(3BZU)
DHI1_HUMAN
[Raw transfer]




OCT_A_9(1Y5M)
DHI1_MOUSE
[Raw transfer]




2 PsiBlast_PDB 97.4787%-125 - C2 -1Y5R 11.1 DHI1_MOUSE
22 PsiBlast_CBE 95.3087%-123 - C2 -1Y5M 9.7 DHI1_MOUSE
1 PsiBlast_PDB 94.9387%-121 - C2 -1Y5M 9.3 DHI1_MOUSE
21 PsiBlast_CBE 94.2987%-115 - C2 -1Y5R 10.9 DHI1_MOUSE
63 Fugue 92.5475%-122 - C2 -1XSE 12.3 DHI1_CAVPO
18 PsiBlast_PDB 92.3177%-119 - C2 -4HX5 13.2 DHI1_HUMAN
73 HHSearch 91.2877%-116 * C2 *1XU9 12.8 DHI1_HUMAN
40 PsiBlast_CBE 90.8477%-121 - C2 -3OQ1 12.5 DHI1_HUMAN
8 PsiBlast_PDB 90.4777%-114 - C2 -3BZU 12.7 DHI1_HUMAN
61 PsiBlast_CBE 89.6177%-117 - C2 -1XU9 13.0 DHI1_HUMAN
39 PsiBlast_CBE 89.5177%-118 - C2 -3QQP 12.4 DHI1_HUMAN
36 PsiBlast_CBE 89.3077%-119 - C2 -4HX5 13.3 DHI1_HUMAN
37 PsiBlast_CBE 89.2077%-118 - C2 -3QQP 12.7 DHI1_HUMAN
14 PsiBlast_PDB 89.1977%-113 - C2 -3FCO 12.3 DHI1_HUMAN
35 PsiBlast_CBE 89.0577%-117 - C2 -4HX5 12.9 DHI1_HUMAN
17 PsiBlast_PDB 89.0577%-117 - C2 -3QQP 12.8 DHI1_HUMAN
11 PsiBlast_PDB 88.8277%-114 - C2 -3D4N 13.1 DHI1_HUMAN
62 PsiBlast_CBE 88.7877%-115 - C2 -1XU7 13.0 DHI1_HUMAN
20 PsiBlast_PDB 88.7377%-114 - C2 -3D5Q 12.3 DHI1_HUMAN
19 PsiBlast_PDB 88.6477%-117 - C2 -3PDJ 13.4 DHI1_HUMAN
42 PsiBlast_CBE 88.5277%-115 - C2 -3OQ1 12.0 DHI1_HUMAN
41 PsiBlast_CBE 88.4477%-112 - C2 -3OQ1 12.6 DHI1_HUMAN
47 PsiBlast_CBE 88.4177%-117 - C2 -3H6K 12.4 DHI1_HUMAN
58 PsiBlast_CBE 88.3877%-116 - C2 -3BZU 12.9 DHI1_HUMAN
49 PsiBlast_CBE 88.1477%-117 - C2 -3FCO 12.0 DHI1_HUMAN
10 PsiBlast_PDB 88.1477%-115 - C2 -3D3E 12.5 DHI1_HUMAN
59 PsiBlast_CBE 88.0677%-116 - C2 -1XU9 12.8 DHI1_HUMAN
15 PsiBlast_PDB 88.0377%-115 - C2 -3H6K 12.4 DHI1_HUMAN
12 PsiBlast_PDB 88.0177%-119 - C2 -3FRJ 13.1 DHI1_HUMAN
4 PsiBlast_PDB 88.0076%-116 - C2 -4BB5 12.9 DHI1_HUMAN
9 PsiBlast_PDB 87.9077%-116 - C2 -3CZR 12.5 DHI1_HUMAN
32 PsiBlast_CBE 87.8876%-114 - C2 -4BB5 13.1 DHI1_HUMAN
45 PsiBlast_CBE 87.8677%-118 - C2 -3H6K 12.4 DHI1_HUMAN
50 PsiBlast_CBE 87.7877%-116 - C2 -3D4N 13.1 DHI1_HUMAN
48 PsiBlast_CBE 87.7677%-117 - C2 -3FRJ 12.9 DHI1_HUMAN
51 PsiBlast_CBE 87.6377%-116 - C2 -3D4N 12.8 DHI1_HUMAN
60 PsiBlast_CBE 87.6277%-117 - C2 -1XU9 13.4 DHI1_HUMAN
38 PsiBlast_CBE 87.5777%-118 - C2 -3QQP 13.0 DHI1_HUMAN
34 PsiBlast_CBE 87.4677%-118 - C2 -4HX5 13.3 DHI1_HUMAN
30 PsiBlast_CBE 87.3876%-114 - C2 -4BB5 12.8 DHI1_HUMAN
6 PsiBlast_PDB 87.2877%-115 - C2 -1XU7 13.2 DHI1_HUMAN
56 PsiBlast_CBE 87.2777%-121 - C2 -3BZU 12.7 DHI1_HUMAN
31 PsiBlast_CBE 87.2676%-117 - C2 -4BB5 12.6 DHI1_HUMAN
57 PsiBlast_CBE 87.1877%-116 - C2 -3BZU 12.9 DHI1_HUMAN
53 PsiBlast_CBE 87.1877%-119 - C2 -3D3E 13.3 DHI1_HUMAN
46 PsiBlast_CBE 87.1077%-116 - C2 -3H6K 12.3 DHI1_HUMAN
13 PsiBlast_PDB 87.0277%-117 - C2 -3HFG 12.7 DHI1_HUMAN
16 PsiBlast_PDB 86.8177%-117 - C2 -3OQ1 11.7 DHI1_HUMAN
5 PsiBlast_PDB 86.6376%-111 - C2 -4BB6 13.2 DHI1_HUMAN
55 PsiBlast_CBE 85.9877%-116 - C2 -3CZR 13.0 DHI1_HUMAN
52 PsiBlast_CBE 85.6877%-116 - C2 -3D3E 12.4 DHI1_HUMAN
44 PsiBlast_CBE 85.6577%-116 - C2 -3HFG 13.1 DHI1_HUMAN
54 PsiBlast_CBE 85.6277%-116 - C2 -3D3E 13.1 DHI1_HUMAN
33 PsiBlast_CBE 85.5176%-120 - C2 -4BB6 13.3 DHI1_HUMAN
43 PsiBlast_CBE 85.0377%-116 - C2 -3HFG 11.3 DHI1_HUMAN