@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00144_BLAC_S: (2014-08-29 )
MKKLIFLIVIALVLSACNSNSSHAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF

Atome Classification :

(11 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ICT_A_3(1W7F)
BLAC_BACLI
[Raw transfer]




ICT_A_3(1W7F)
BLAC_BACLI
[Raw transfer]




CED_A_8(1GHM)
BLAC_STAAU
[Raw transfer]




CIT_A_5(1I2S)
BLAC_BACLI
[Raw transfer]




A33_A_3(3B3X)
BLAC_BACLI
[Raw transfer]




CFX_A_3(1I2W)
BLAC_BACLI
[Raw transfer]




CEM_A_3(1BLC)
BLAC_STAAU
[Raw transfer]




PNM_A_6(1GHP)
BLAC_STAAU
[Raw transfer]




PNM_A_6(1GHP)
BLAC_STAAU
[Raw transfer]




EPE_A_11(3LEZ)
?
[Raw transfer]




MES_A_3(1HZO)
BLAB_PROVU
[Raw transfer]




FOS_C_3(1BLH)
BLAC_STAAU
[Raw transfer]




BIY_A_3(2WK0)
BLAC_BACLI
[Raw transfer]




3 PsiBlast_PDB 95.88100% -58 - C1 -1BLH 3.2 BLAC_STAAU
2 PsiBlast_PDB 94.27100% -56 - C1 -1BLC 1.9 BLAC_STAAU
31 HHSearch 93.7499% -58 - C1 -1GHP 3.9 BLAC_STAAU
13 PsiBlast_PDB 93.6599% -56 - C1 -1GHM 5.0 BLAC_STAAU
35 HHSearch 76.3542% -46 - C1 -2WK0 3.7 BLAC_BACLI
32 HHSearch 74.4741% -44 * C1 *1W7F 3.4 BLAC_BACLI
18 PsiBlast_PDB 72.3144% -46 - C1 -1I2S 3.7 BLAC_BACLI
19 PsiBlast_PDB 72.2744% -49 - C1 -1I2W 3.7 BLAC_BACLI
20 PsiBlast_PDB 72.0544% -53 - C1 -3B3X 3.9 BLAC_BACLI
37 HHSearch 71.8535% -41 - C1 -3LEZ 2.4 ?
45 HHSearch 70.3235% -41 - C1 -1HZO 3.3 BLAB_PROVU