@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00156_HGXR_P: (2014-08-29 )
MPIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IRP_C_17(1CJB)
HGXR_PLAFG
[Raw transfer]




SSI_A_5(3OZG)
HGXR_PLAFG
[Raw transfer]




IMP_A_5(1QK4)
HGXR_TOXGO
[Raw transfer]




SSI_C_11(3OZG)
HGXR_PLAFG
[Raw transfer]




5GP_E_5(1HMP)
HPRT_HUMAN
[Raw transfer]




SSI_B_9(3OZG)
HGXR_PLAFG
[Raw transfer]




XMP_A_3(1QK5)
HGXR_TOXGO
[Raw transfer]




IMU_A_13(1BZY)
HPRT_HUMAN
[Raw transfer]




SSI_D_14(3OZG)
HGXR_PLAFG
[Raw transfer]




24H_A_3(3GEP)
HPRT_HUMAN
[Raw transfer]




PRP_A_7(1FSG)
HGXR_TOXGO
[Raw transfer]




PRP_A_6(1D6N)
HPRT_HUMAN
[Raw transfer]




25H_A_3(3GGJ)
HPRT_HUMAN
[Raw transfer]




SV2_A_5(4IJQ)
HPRT_HUMAN
[Raw transfer]




H26_A_4(3GGC)
HPRT_HUMAN
[Raw transfer]




HPA_A_5(3OZF)
HGXR_PLAFG
[Raw transfer]




HPA_C_13(3OZF)
HGXR_PLAFG
[Raw transfer]




HPA_D_21(3OZF)
HGXR_PLAFG
[Raw transfer]




HPA_B_9(3OZF)
HGXR_PLAFG
[Raw transfer]




9DG_A_8(1FSG)
HGXR_TOXGO
[Raw transfer]




POP_C_14(3OZF)
HGXR_PLAFG
[Raw transfer]




PPO_A_5(1D6N)
HPRT_HUMAN
[Raw transfer]




POP_C_12(3OZG)
HGXR_PLAFG
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




POP_A_6(3OZG)
HGXR_PLAFG
[Raw transfer]




POP_B_10(3OZF)
HGXR_PLAFG
[Raw transfer]




POP_C_18(1CJB)
HGXR_PLAFG
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




5GP_A_5(2VFA)
HGXR_PLAFG
[Raw transfer]




POP_A_6(3OZF)
HGXR_PLAFG
[Raw transfer]




POP_A_6(3OZF)
HGXR_PLAFG
[Raw transfer]




POP_D_22(3OZF)
HGXR_PLAFG
[Raw transfer]




MES_E_5(1TC1)
?
[Raw transfer]




POP_B_10(3OZG)
HGXR_PLAFG
[Raw transfer]




FMB_C_3(1TC1)
?
[Raw transfer]




POP_D_15(3OZG)
HGXR_PLAFG
[Raw transfer]




POP_A_14(1BZY)
HPRT_HUMAN
[Raw transfer]




POP_A_4(1QK5)
HGXR_TOXGO
[Raw transfer]




36 HHSearch 96.24100%-155 - C3 -3OZF 3.8 HGXR_PLAFG
24 PsiBlast_CBE 95.68100%-156 - C3 -3OZF 3.5 HGXR_PLAFG
21 PsiBlast_CBE 95.66100%-153 - C3 -3OZG 6.6 HGXR_PLAFG
25 PsiBlast_CBE 95.47100%-156 - C3 -3OZF 3.5 HGXR_PLAFG
23 PsiBlast_CBE 95.02100%-155 - C3 -3OZF 3.5 HGXR_PLAFG
17 PsiBlast_CBE 94.92100%-153 - C3 -1CJB 7.1 HGXR_PLAFG
20 PsiBlast_CBE 94.84100%-154 - C3 -3OZG 6.4 HGXR_PLAFG
22 PsiBlast_CBE 94.74100%-157 - C3 -3OZG 6.8 HGXR_PLAFG
2 PsiBlast_PDB 94.05100%-154 - C3 -3OZG 6.5 HGXR_PLAFG
5 PsiBlast_PDB 75.7951%-157 - C3 -1QK4 6.2 HGXR_TOXGO
6 PsiBlast_PDB 75.3451%-149 - C3 -1FSG 7.2 HGXR_TOXGO
7 PsiBlast_PDB 74.7850%-168 - C3 -1QK5 6.1 HGXR_TOXGO
3 PsiBlast_PDB 74.3370%-168 - C3 -2VFA 3.9 HGXR_PLAFG (first)
13 PsiBlast_PDB 73.4849%-166 - C3 -3GGC 6.0 HPRT_HUMAN
14 PsiBlast_PDB 71.8349%-160 - C3 -3GGJ 6.3 HPRT_HUMAN
8 PsiBlast_PDB 71.6749%-165 - C3 -4IJQ 5.3 HPRT_HUMAN
10 PsiBlast_PDB 71.5349%-152 - C3 -1BZY 7.5 HPRT_HUMAN
12 PsiBlast_PDB 71.2049%-166 - C3 -3GEP 7.4 HPRT_HUMAN
15 PsiBlast_PDB 69.8348%-156 - C3 -1D6N 4.8 HPRT_HUMAN
9 PsiBlast_PDB 69.4849%-166 - C3 -1HMP 6.2 HPRT_HUMAN
40 HHSearch 57.9630%-173 - C3 -1TC1 3.2 ?
44 HHSearch 55.3433%-158 - C3 -3HVU 2.4 ?
47 HHSearch 54.9030%-158 * C3 *1YFZ 5.2 ?