@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00186_DYR_BO: (2014-08-30 )
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSSVYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKFEVYEKNN

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COP_A_3(1OHK)
DYR_HUMAN
[Raw transfer]




CO4_C_3(1PD8)
DYR_HUMAN
[Raw transfer]




06U_B_10(4KAK)
DYR_HUMAN
[Raw transfer]




06U_A_4(4KAK)
DYR_HUMAN
[Raw transfer]




CO4_D_4(1PD9)
DYR_HUMAN
[Raw transfer]




1R0_A_4(4KFJ)
DYR_HUMAN
[Raw transfer]




DTM_D_4(1MVS)
DYR_HUMAN
[Raw transfer]




TQD_D_4(1S3U)
DYR_HUMAN
[Raw transfer]




VG9_A_4(2W3B)
DYR_HUMAN
[Raw transfer]




51P_A_2(3GYF)
DYR_HUMAN
[Raw transfer]




3TZ_A_2(3NTZ)
DYR_HUMAN
[Raw transfer]




1QZ_A_4(4KEB)
DYR_HUMAN
[Raw transfer]




FOL_B_6(2W3M)
DYR_HUMAN
[Raw transfer]




DH3_C_3(2FZJ)
DYR_MOUSE
[Raw transfer]




FOL_B_10(4KFJ)
DYR_HUMAN
[Raw transfer]




TQD_D_4(1S3V)
DYR_HUMAN
[Raw transfer]




21V_A_2(4M6L)
DYR_HUMAN
[Raw transfer]




51P_A_3(3K45)
DYR_MOUSE
[Raw transfer]




684_A_7(3S7A)
DYR_HUMAN
[Raw transfer]




D2E_A_3(3NXT)
DYR_HUMAN
[Raw transfer]




FOL_B_6(4KEB)
DYR_HUMAN
[Raw transfer]




9DR_B_8(4KD7)
DYR_HUMAN
[Raw transfer]




9DR_A_4(4KD7)
DYR_HUMAN
[Raw transfer]




3TU_A_3(3NU0)
DYR_HUMAN
[Raw transfer]




FOL_A_2(4M6K)
DYR_HUMAN
[Raw transfer]




FOL_A_4(2W3M)
DYR_HUMAN
[Raw transfer]




VG9_B_8(2W3B)
DYR_HUMAN
[Raw transfer]




D2H_A_3(3NXY)
DYR_HUMAN
[Raw transfer]




DTM_D_4(1MVT)
DYR_HUMAN
[Raw transfer]




D2D_A_7(3NXR)
DYR_HUMAN
[Raw transfer]




TQT_A_3(1S3W)
DYR_HUMAN
[Raw transfer]




DH1_A_2(3F8Y)
DYR_HUMAN
[Raw transfer]




D2Q_A_2(3NZD)
DYR_HUMAN
[Raw transfer]




D2F_A_2(3NXV)
DYR_HUMAN
[Raw transfer]




25U_A_3(4KBN)
DYR_HUMAN
[Raw transfer]




TOP_A_6(2W3A)
DYR_HUMAN
[Raw transfer]




D2D_A_3(3NXX)
DYR_HUMAN
[Raw transfer]




TOP_B_9(2W3A)
DYR_HUMAN
[Raw transfer]




DH1_A_2(3FS6)
DYR_HUMAN
[Raw transfer]




MMV_A_3(4DDR)
DYR_HUMAN
[Raw transfer]




GOL_X_3(3D84)
DYR_MOUSE
[Raw transfer]




DZF_B_4(2DHF)
DYR_HUMAN
[Raw transfer]




25U_B_15(4KBN)
DYR_HUMAN
[Raw transfer]




D2N_X_2(3NZB)
DYR_PNECA
[Raw transfer]




GW3_A_4(1AOE)
DYR_CANAX
[Raw transfer]




39B_A_4(2C2T)
DYR_HUMAN
[Raw transfer]




OAG_A_2(4G95)
?
[Raw transfer]




39B_B_7(2C2T)
DYR_HUMAN
[Raw transfer]




N22_A_5(3CSE)
?
[Raw transfer]




D09_A_2(3K47)
DYR_MOUSE
[Raw transfer]




FOL_A_3(1DHF)
DYR_HUMAN
[Raw transfer]




GHW_A_2(3GHW)
DYR_HUMAN
[Raw transfer]




GHW_A_2(3GI2)
DYR_HUMAN
[Raw transfer]




MTX_C_3(1U72)
DYR_HUMAN
[Raw transfer]




WRA_A_4(3RG9)
DRTS_TRYBB
[Raw transfer]




MTX_B_2(1U70)
DYR_MOUSE
[Raw transfer]




DZF_A_3(2DHF)
DYR_HUMAN
[Raw transfer]




34B_B_6(2C2S)
DYR_HUMAN
[Raw transfer]




34B_A_4(2C2S)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3NZD)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3K47)
DYR_MOUSE
[Raw transfer]




NDP_A_3(1AOE)
DYR_CANAX
[Raw transfer]




NAP_A_4(3NRR)
?
[Raw transfer]




NAP_A_2(1S3W)
DYR_HUMAN
[Raw transfer]




NDP_A_3(2C2S)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3NXV)
DYR_HUMAN
[Raw transfer]




NAP_X_3(3NZB)
DYR_PNECA
[Raw transfer]




NDP_B_7(2W3B)
DYR_HUMAN
[Raw transfer]




WRA_A_5(1J3K)
DRTS_PLAFK
[Raw transfer]




NDP_A_3(2W3M)
DYR_HUMAN
[Raw transfer]




NAP_B_2(2FZJ)
DYR_MOUSE
[Raw transfer]




NDP_A_2(3NU0)
DYR_HUMAN
[Raw transfer]




NDP_C_3(1U70)
DYR_MOUSE
[Raw transfer]




NDP_A_3(3FS6)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3NTZ)
DYR_HUMAN
[Raw transfer]




NAP_A_3(4M6L)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3GHW)
DYR_HUMAN
[Raw transfer]




NDP_A_2(4DDR)
DYR_HUMAN
[Raw transfer]




NAP_A_3(4KEB)
DYR_HUMAN
[Raw transfer]




NDP_B_6(2C2T)
DYR_HUMAN
[Raw transfer]




NDP_B_5(2W3M)
DYR_HUMAN
[Raw transfer]




NAP_B_5(4KEB)
DYR_HUMAN
[Raw transfer]




NDP_B_8(2W3A)
DYR_HUMAN
[Raw transfer]




NDP_B_5(2C2S)
DYR_HUMAN
[Raw transfer]




NAP_X_2(3D84)
DYR_MOUSE
[Raw transfer]




NAP_A_3(4M6K)
DYR_HUMAN
[Raw transfer]




NDP_B_2(1U72)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3GI2)
DYR_HUMAN
[Raw transfer]




NDP_A_3(2C2T)
DYR_HUMAN
[Raw transfer]




NAP_A_3(3CSE)
?
[Raw transfer]




NDP_A_2(3NXY)
DYR_HUMAN
[Raw transfer]




NDP_A_3(2W3B)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3GYF)
DYR_HUMAN
[Raw transfer]




NDP_A_2(3K45)
DYR_MOUSE
[Raw transfer]




CP6_A_3(3QG2)
?
[Raw transfer]




NAP_B_7(4KD7)
DYR_HUMAN
[Raw transfer]




NDP_A_2(3D80)
DYR_MOUSE
[Raw transfer]




NDP_A_2(3NXT)
DYR_HUMAN
[Raw transfer]




NAP_A_3(4KD7)
DYR_HUMAN
[Raw transfer]




NDP_A_2(2BL9)
DRTS_PLAVI
[Raw transfer]




NDP_A_3(3F8Y)
DYR_HUMAN
[Raw transfer]




NDP_B_2(1PD8)
DYR_HUMAN
[Raw transfer]




NAP_A_3(4KFJ)
DYR_HUMAN
[Raw transfer]




NDP_A_2(4M6J)
DYR_HUMAN
[Raw transfer]




NDP_A_2(3NXX)
DYR_HUMAN
[Raw transfer]




NDP_A_4(2W3A)
DYR_HUMAN
[Raw transfer]




NDP_A_6(1J3K)
DRTS_PLAFK
[Raw transfer]




NAP_B_(4KBN)
DYR_HUMAN
[Raw transfer]




NDP_A_2(1OHK)
DYR_HUMAN
[Raw transfer]




NDP_A_2(3NXR)
DYR_HUMAN
[Raw transfer]




NAP_B_9(4KFJ)
DYR_HUMAN
[Raw transfer]




D16_A_5(3NRR)
?
[Raw transfer]




NDP_A_4(3QG2)
?
[Raw transfer]




NAP_A_3(4KAK)
DYR_HUMAN
[Raw transfer]




NAP_B_9(4KAK)
DYR_HUMAN
[Raw transfer]




NAP_A_12(4KBN)
DYR_HUMAN
[Raw transfer]




ATR_A_3(4KLX)
DYR_MYCTU
[Raw transfer]




CP6_A_3(2BL9)
DRTS_PLAVI
[Raw transfer]




Q22_A_3(3D80)
DYR_MOUSE
[Raw transfer]




EOH_A_5(4KAK)
DYR_HUMAN
[Raw transfer]




36 PsiBlast_CBE 98.5387%-138 - C2 -4KEB 12.0 DYR_HUMAN
28 PsiBlast_CBE 97.3587%-136 - C2 -2W3B 11.7 DYR_HUMAN
42 PsiBlast_CBE 97.0787%-137 - C2 -4KAK 11.5 DYR_HUMAN
30 PsiBlast_CBE 96.9387%-137 - C2 -2W3A 11.3 DYR_HUMAN
20 PsiBlast_PDB 96.8787%-134 - C2 -2C2S 11.7 DYR_HUMAN
29 PsiBlast_CBE 96.8287%-137 - C2 -2W3B 12.5 DYR_HUMAN
59 PsiBlast_CBE 96.7487%-133 - C2 -2C2S 11.8 DYR_HUMAN
58 PsiBlast_CBE 96.6787%-135 - C2 -2C2T 12.1 DYR_HUMAN
40 PsiBlast_CBE 96.6287%-134 - C2 -4KBN 11.9 DYR_HUMAN
26 PsiBlast_CBE 96.4987%-136 - C2 -2W3M 12.0 DYR_HUMAN
34 PsiBlast_CBE 96.3487%-134 - C2 -4KFJ 12.1 DYR_HUMAN
41 PsiBlast_CBE 96.3387%-133 - C2 -4KBN 11.6 DYR_HUMAN
31 PsiBlast_CBE 96.3287%-135 - C2 -2W3A 11.1 DYR_HUMAN
27 PsiBlast_CBE 96.3187%-134 - C2 -2W3M 12.1 DYR_HUMAN
5 PsiBlast_PDB 96.3189%-130 - C2 -3K45 12.5 DYR_MOUSE
2 PsiBlast_PDB 96.1789%-133 - C2 -3D80 10.4 DYR_MOUSE
37 PsiBlast_CBE 96.0987%-132 - C2 -4KEB 12.1 DYR_HUMAN
35 PsiBlast_CBE 96.0987%-129 - C2 -4KFJ 12.3 DYR_HUMAN
57 PsiBlast_CBE 95.9887%-132 - C2 -2C2T 12.0 DYR_HUMAN
13 PsiBlast_PDB 95.9687%-130 - C2 -1PD8 9.5 DYR_HUMAN
43 PsiBlast_CBE 95.8687%-132 - C2 -4KAK 11.9 DYR_HUMAN
1 PsiBlast_PDB 95.4089%-135 - C2 -2FZJ 9.9 DYR_MOUSE
49 PsiBlast_CBE 95.3787%-131 - C2 -3NXX 12.0 DYR_HUMAN
32 PsiBlast_CBE 95.3787%-129 - C2 -1MVT 7.1 DYR_HUMAN
4 PsiBlast_PDB 95.3789%-126 - C2 -3K47 11.1 DYR_MOUSE
22 PsiBlast_CBE 95.3287%-130 - C2 -4M6K 11.9 DYR_HUMAN
50 PsiBlast_CBE 95.1687%-133 - C2 -3NXV 10.2 DYR_HUMAN
21 PsiBlast_CBE 95.1187%-129 - C2 -4M6L 10.9 DYR_HUMAN
55 PsiBlast_CBE 95.1087%-131 - C2 -3GHW 11.8 DYR_HUMAN
14 PsiBlast_PDB 95.0887%-132 - C2 -1PD9 6.7 DYR_HUMAN
61 Fugue 94.9688%-135 - C2 -1DHF 8.0 DYR_HUMAN
25 PsiBlast_CBE 94.9687%-130 - C2 -3FS6 11.0 DYR_HUMAN
39 PsiBlast_CBE 94.8587%-130 - C2 -4KD7 11.1 DYR_HUMAN
24 PsiBlast_CBE 94.8487%-135 - C2 -3GYF 11.8 DYR_HUMAN
33 PsiBlast_CBE 94.7787%-132 - C2 -1MVS 6.3 DYR_HUMAN
52 PsiBlast_CBE 94.6787%-132 - C2 -3NXR 11.6 DYR_HUMAN
44 PsiBlast_CBE 94.6487%-133 - C2 -4G95 6.8 ?
51 PsiBlast_CBE 94.5987%-130 - C2 -3NXT 11.3 DYR_HUMAN
16 PsiBlast_PDB 94.5187%-132 - C2 -1S3U 6.8 DYR_HUMAN
53 PsiBlast_CBE 94.4987%-129 - C2 -3NU0 11.8 DYR_HUMAN
54 PsiBlast_CBE 94.3487%-128 - C2 -3NTZ 11.6 DYR_HUMAN
48 PsiBlast_CBE 94.3387%-132 - C2 -3NXY 10.6 DYR_HUMAN
8 PsiBlast_PDB 94.2986%-131 - C2 -3GI2 11.2 DYR_HUMAN
6 PsiBlast_PDB 94.2589%-125 - C2 -1U70 10.3 DYR_MOUSE
18 PsiBlast_PDB 94.2387%-131 - C2 -1S3W 10.7 DYR_HUMAN
3 PsiBlast_PDB 94.0989%-130 - C2 -3D84 10.9 DYR_MOUSE
23 PsiBlast_CBE 94.0087%-128 - C2 -4M6J 12.6 DYR_HUMAN
38 PsiBlast_CBE 93.8487%-130 - C2 -4KD7 11.2 DYR_HUMAN
46 PsiBlast_CBE 93.7187%-133 - C2 -3S7A 9.0 DYR_HUMAN
10 PsiBlast_PDB 93.5487%-133 - C2 -2DHF 8.7 DYR_HUMAN
56 PsiBlast_CBE 93.5087%-131 - C2 -2DHF 9.2 DYR_HUMAN
47 PsiBlast_CBE 93.4887%-129 - C2 -3NZD 6.7 DYR_HUMAN
60 PsiBlast_CBE 93.4087%-128 * C2 *1OHK 8.0 DYR_HUMAN
19 PsiBlast_PDB 93.3887%-125 - C2 -1U72 10.6 DYR_HUMAN
7 PsiBlast_PDB 93.0886%-128 - C2 -3F8Y 10.9 DYR_HUMAN
45 PsiBlast_CBE 91.7687%-125 - C2 -4DDR 11.5 DYR_HUMAN
17 PsiBlast_PDB 85.3487%-129 - C2 -1S3V 7.4 DYR_HUMAN
70 HHSearch 66.3036%-116 - C2 -3CSE 13.1 ?
78 HHSearch 65.5336%-126 - C2 -1AOE 12.6 DYR_CANAX
76 HHSearch 65.3437%-104 - C2 -3NZB 11.0 DYR_PNECA
82 HHSearch 61.1832%-115 - C2 -3NRR 12.3 ?
73 HHSearch 59.4533% -96 - C2 -3RG9 6.5 DRTS_TRYBB
74 HHSearch 56.7834% -89 - C2 -2BL9 11.4 DRTS_PLAVI
80 HHSearch 54.3032%-117 - C2 -4KLX 8.6 DYR_MYCTU
79 HHSearch 54.3033% -96 - C2 -1J3K 11.8 DRTS_PLAFK
83 HHSearch 52.5033% -88 - C2 -3QG2 9.9 ?